DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and b3galnt2

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001018523.1 Gene:b3galnt2 / 553716 ZFINID:ZDB-GENE-050522-358 Length:491 Species:Danio rerio


Alignment Length:162 Identity:42/162 - (25%)
Similarity:66/162 - (40%) Gaps:24/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATP 252
            |..|:..|||::..:....|||:..|.:...||..|. |...||:|.|||.|::...::.     
Zfish   303 LQEESLRHGDMVFVDVVGTYRNVPSKLLQFYKWSVEN-ADFSLLLKTDDDCFIDVDAVLM----- 361

  Fly   253 SLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRV------TYKEYPNRFYPEYCPGMAIVYAPEV 311
                       .:...|..|.|....::|..|.|      ...||.:..||.:..|...|.:.::
Zfish   362 -----------KMQRRRLTHTSLWWGNFRQNWAVDRVGKWQELEYASPAYPAFACGSGYVVSRDL 415

  Fly   312 VRRLYEAAQKSKYFWVDDVLITGILAEETGSK 343
            |:.|...||..|.:..:||.: ||.....|.:
Zfish   416 VQWLASNAQHLKAYQGEDVSM-GIWMAAVGPR 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 42/162 (26%)
b3galnt2NP_001018523.1 Galactosyl_T 300..444 CDD:304462 41/158 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.