DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and b3gnt3.1

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_005166892.1 Gene:b3gnt3.1 / 494166 ZFINID:ZDB-GENE-040625-129 Length:424 Species:Danio rerio


Alignment Length:347 Identity:84/347 - (24%)
Similarity:154/347 - (44%) Gaps:47/347 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 SQTPTPPQS----SMHLMDLPNFVYLIDQ-----------------PACDK--------DVRALI 138
            :|||.|..:    :|....||.|..|.|.                 ...||        ||..|:
Zfish    86 TQTPEPSSAPCYPNMSAYKLPEFSTLQDHIKDFLLYRHCKSFPMILDVHDKCGGAQNSADVFLLL 150

  Fly   139 LVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQ--QFLGRENHLHGDLIQG 201
            ::.|:..|.::|.::|:|||.........::..|::|...:..||.:  :.|..||:.:.|::|.
Zfish   151 VIKSSPENYDRREVLRKTWAEERLHKGVWIRRVFIIGTSRSGFEKHRLNRLLKLENNENKDILQW 215

  Fly   202 NFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLM 266
            :|.|::.|:|.|.::.|:|.:.:|.:|:.|:..|||:|.||..:::||......:.|.    :|.
Zfish   216 DFNDSFFNLTLKQILFLQWMDRRCPNARFLLDGDDDIFANTFNMIEYLQGQEDNDGSR----HLF 276

  Fly   267 LCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVL 331
            ....:...:..|...||:.|..:.:.:..||.||.|...:.:....|.:|:.:.......:|||.
Zfish   277 TGHLLQKVKPIRKLSSKYYVPVQIHESNRYPPYCGGGGFLLSGFTARTIYKMSHSIILLPIDDVY 341

  Fly   332 ITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLEDPPF---LFTNHAIKPDESMTIWQMALDR 393
            : |:..|:.|  :.|..|:..:.....:....||..||.:   :...|..:|.....:|    :.
Zfish   342 M-GMCLEKAG--LQPTFHFGVRTFGMNVPIKNADKLDPCYYREILVVHRFQPHMIFVMW----NE 399

  Fly   394 MQRPLL--TQPAYSSASSASRS 413
            :|.|.|  ::..||..:|.:.|
Zfish   400 IQNPDLQCSKTHYSLQTSTTSS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 51/200 (26%)
b3gnt3.1XP_005166892.1 Galactosyl_T 160..354 CDD:304462 51/200 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6332
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.