DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and bus-17

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001025003.2 Gene:bus-17 / 3565831 WormBaseID:WBGene00044630 Length:340 Species:Caenorhabditis elegans


Alignment Length:267 Identity:60/267 - (22%)
Similarity:107/267 - (40%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TPPTLASQTPTPPQ----------------SSMHLMDLPNFVYLIDQPACDKDVRALILVHSAVR 145
            |...|.|..|..|.                .:..|..:|:.:...|.|...|   .::::.|...
 Worm    59 TQSDLLSTEPRDPDFQTCVNKFFPNREADPENCKLDKIPDVLIRPDLPEYPK---RILVIRSGPG 120

  Fly   146 NIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNM 210
            :::.|..||.||..:.   :|.:.|.|    |.|.|:  ...|..|.:.:.|::|.:|:|:|.|:
 Worm   121 SLDYRNFIRRTWKQQV---ETLVPVVF----VCATSK--NDTLKIEANKYRDILQFDFEDSYHNL 176

  Fly   211 TYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSR 275
            ::|.:....:..::......:|..:||..:|...|.:.|        .|.:.|.::       .:
 Worm   177 SWKMMAIYGFVIDQLPSVDQIVVTNDDTIVNATALEQVL--------HMKKGPVML-------GK 226

  Fly   276 VKRSYRS------KWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITG 334
            |.|.|..      .|.|..:.|||..||.:..|.:.|.:.:..:.|.|...|.....:|||.: |
 Worm   227 VSRGYPRIFLPWLTWHVPSEMYPNLCYPLFVQGSSFVLSKDGAKLLVENVCKVPMVHLDDVFM-G 290

  Fly   335 ILAEETG 341
            :|:...|
 Worm   291 VLSNCVG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 49/200 (25%)
bus-17NP_001025003.2 Galactosyl_T 125..304 CDD:304462 49/198 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.