DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and brn

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster


Alignment Length:283 Identity:81/283 - (28%)
Similarity:125/283 - (44%) Gaps:36/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LPNFVYL----------IDQPACDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYF 172
            |..|.||          :||||     |..:|:.|||.|..:|..||.||..........|:..|
  Fly    57 LDKFAYLRVPSFTAEVPVDQPA-----RLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVF 116

  Fly   173 LVGGV--SAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVD 235
            |:|..  |.|...|      |:..|||::|..|.|||.|.|.|.::.::|.:::...::..:.||
  Fly   117 LLGTAEDSEKDVAW------ESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVD 175

  Fly   236 DDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYC 300
            ||.:::...::|:|.     .......|.|:....|..:...|...|||.|:.:|||...:|.|.
  Fly   176 DDYYVSAKNVLKFLG-----RGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYV 235

  Fly   301 PGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEAD 365
            ...|.:.:.:.:|:||.|:.....|..|||.: ||:|.:.|   ..|||..:.:..|....|...
  Fly   236 TAGAFILSQKALRQLYAASVHLPLFRFDDVYL-GIVALKAG---ISLQHCDDFRFHRPAYKGPDS 296

  Fly   366 LEDPPFLFTNHAIKPDESMT-IW 387
            ...   :..:|.....|.|| :|
  Fly   297 YSS---VIASHEFGDPEEMTRVW 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 57/200 (29%)
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 60/204 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm47879
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
98.870

Return to query results.
Submit another query.