DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3gnt3

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001099538.1 Gene:B3gnt3 / 290638 RGDID:1305151 Length:378 Species:Rattus norvegicus


Alignment Length:384 Identity:102/384 - (26%)
Similarity:158/384 - (41%) Gaps:68/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TAQPPTSAKSGLRRSRSQPNQIHQPSRTPSNSNDSSLVSNTFDNHPMGTPPTLA-SQTPTPPQSS 112
            |.|.|.|..:        |....:|...|:.:.|.|..      |.......|: |..|...:..
  Rat    24 TCQSPPSCPA--------PESPTEPKDDPAWAPDLSRA------HAAPCRANLSVSAHPAFARLP 74

  Fly   113 MHLMDL------PNFVYLIDQPA--CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLK 169
            .|:.|.      .:|..|.:..|  |.:....|:.:.|:..|..:|:::|.|||....:....|:
  Rat    75 SHVRDFLLYRHCRDFAVLREPKATKCAQPAFLLLAIKSSPANYGRRQVLRTTWARERRVRGASLR 139

  Fly   170 VYFLVGG--VSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLV 232
            ..||||.  ...::.|:.:.|..|...:||::|.:|.|::.|:|.|.|:.|:|....|.:|..::
  Rat   140 RLFLVGSDRDPQQARKFNRLLELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCTNASFVL 204

  Fly   233 KVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNL-----MLCRSVHHSRVKRS-YRSKWRVTYKEY 291
            ..|||||.:|..:|.||..         |||:.     .|.::|...||..| |.....||.::.
  Rat   205 NGDDDVFAHTDNMVTYLQG---------RDPDQHLFVGHLIQNVGPIRVPWSKYFIPTLVTAEDK 260

  Fly   292 PNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDV 356
                ||.||.|...:.:...:..|:.||:....|.:|||.: |:..::.|  :.|..|    ..|
  Rat   261 ----YPPYCGGGGFLLSRFTMAALHRAARVLPIFPIDDVFL-GMCLQQQG--LAPGAH----SGV 314

  Fly   357 RKLVGG------EADLEDPPF---LFTNHAIKPDESMTIW------QMALDRMQRPLLT 400
            |  ..|      .....||.|   |...|...|.|.:.:|      |:|..|...||||
  Rat   315 R--TAGVLPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALSRPQLACGRQSPPLLT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 60/206 (29%)
B3gnt3NP_001099538.1 Galactosyl_T 119..308 CDD:419759 60/204 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.