DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3galt5

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001099357.1 Gene:B3galt5 / 288161 RGDID:1306727 Length:308 Species:Rattus norvegicus


Alignment Length:298 Identity:78/298 - (26%)
Similarity:134/298 - (44%) Gaps:58/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DLPNFVY------LIDQPACD---KDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYF 172
            :|| ||:      .:..|..|   |....::||.|:.:.:..|..||:||...:.:...|::.:|
  Rat    30 ELP-FVFKKSHGKFLQLPEIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQPVRTFF 93

  Fly   173 LVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDD 237
            |:|  |:.|.:.......|:..|.|:||.:|||||.|:|.|.:|.::|....|.....::|.|.|
  Rat    94 LLG--SSDSTEDMDATALESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSD 156

  Fly   238 VFMNTPQLVKYLATPSLPEYSMLR------DPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFY 296
            :|:|    |.||....|.:....|      .|        |...:::.: :||.|:..|||...|
  Rat   157 MFVN----VGYLTELLLKKNKTTRFFTGYIKP--------HDFPIRQKF-NKWFVSKFEYPWDRY 208

  Fly   297 PEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQK------- 354
            |.:|.|...|::.:|..::|..::...:..::||.:...||:   .||.|.:.:.:|.       
  Rat   209 PPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFVGLCLAK---LKIRPEELHTKQTFFPGGLR 270

  Fly   355 ----DVRKLVGGEADLEDPPFLFTNHAIKPDESMTIWQ 388
                ..:|:|             ..|.:||.:.:|.||
  Rat   271 FSVCRFQKIV-------------ACHFMKPQDLLTYWQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 58/204 (28%)
B3galt5NP_001099357.1 Galactosyl_T 69..259 CDD:304462 59/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.