DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and CG30037

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_725097.2 Gene:CG30037 / 246409 FlyBaseID:FBgn0050037 Length:420 Species:Drosophila melanogaster


Alignment Length:386 Identity:93/386 - (24%)
Similarity:146/386 - (37%) Gaps:88/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FDNHPMGTPPTLASQTPTPPQSSMHLMD-LPNFVYLIDQPACDKDVRALILVHSAVRNIEKRRII 153
            |...|.....:||..:...|:|....:| ..:...::.:..|.......|.|.|.|.:.|:||.|
  Fly    43 FKPDPSKRTASLAGWSRDAPRSVADYLDPTKDTALIVPRHFCRSKALLTIAVCSYVHHFERRRAI 107

  Fly   154 RETWANRS-----------------YIDQTP--LKVY------------------FLVGGVSAKS 181
            |:.|.|.:                 |.|..|  ||:|                  |:||..:..|
  Fly   108 RKLWGNFTDFNYSVFVKLHGHLKGRYQDVLPERLKLYSEYLSGEGDSLRASIRLVFIVGRRNLAS 172

  Fly   182 EKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAH-AQLLVKVDDDVFMNTPQL 245
            ....:.:..|...:.|:||.||.|.|.|:|.|.|||||...:.|.: .....|.|||.|:|.|.:
  Fly   173 LLENEAVAIEAQKYNDVIQENFIDTYNNLTIKAVMALKHITQSCLNTTAFYFKCDDDTFVNVPNI 237

  Fly   246 VKYLATPSLP------------EYSMLRDPNLMLCR-----SVHHSRVKRSYR--SKWRVTYKEY 291
            :.:|...::|            .|.:......:..|     ...|..|..:..  :||.:....:
  Fly   238 LHFLLGGTIPVNVVTAGFHYGNTYEVTSPRKRLTARREMMYGRQHCNVPPATNKLNKWYMPSYMF 302

  Fly   292 PNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKIT--PL--QHYLE 352
            ....||.|..|...:.:.:||.|||:|:..::...::|:.:||:.||:.|.|.|  ||  ..|..
  Fly   303 RGGVYPRYLCGSGYLLSIDVVPRLYKASLGTRIVHLEDMFVTGLCAEKAGIKRTNHPLFRSSYPY 367

  Fly   353 QKDVRKLVGGEADLEDPPFLFTNHAIKPDESMTIW-----------------QMALDRMQR 396
            :.|.:..:.|.         ||.|..|.:.....|                 .:.|.:|||
  Fly   368 EGDEQCALKGS---------FTVHRAKDNVMWEAWYRVTNFSSKCPPPQKDFHLRLPKMQR 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 67/257 (26%)
CG30037NP_725097.2 Galactosyl_T 102..359 CDD:304462 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
76.820

Return to query results.
Submit another query.