DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and CG30036

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster


Alignment Length:327 Identity:84/327 - (25%)
Similarity:134/327 - (40%) Gaps:69/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NFVYLIDQPACDKDVRALILVHSAVRNIEKRRIIRETWANR-----------------SYIDQTP 167
            |...::.:..|......:|.|.|.:.:.|:|..||:||.|.                 .|:...|
  Fly    44 NTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMP 108

  Fly   168 --LKVY------------------FLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTY 212
              ||:|                  |::|.....|::....|.||:..|.|:||.||.|:|.|:|.
  Fly   109 GRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTL 173

  Fly   213 KHVMALKWFNEKCA-HAQLLVKVDDDVFMNTPQLVKYLATPSLPEYS-----------MLRDP-- 263
            |.|||||..::.|| .|...:|.|||.|:|.|.|:.:|...::|.|.           .::.|  
  Fly   174 KSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWN 238

  Fly   264 ------NLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKS 322
                  .||......:.:.....:|.|.:.|..:....||:|..|...:.:.:||:|||..|..:
  Fly   239 RLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTT 303

  Fly   323 KYFWVDDVLITGILAEETG--SKITPLQHYLEQKDVRKLVGGEADLEDPPFLFTNHAIKPDESMT 385
            ....::||.:|||.|::.|  .:..||.:|:..|.:....|          ..|.|.:.....:.
  Fly   304 SLVHLEDVFVTGICAKKAGIRRRHQPLFNYVHGKPLCIFKG----------TITMHPVPLHSMLD 358

  Fly   386 IW 387
            .|
  Fly   359 AW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 71/257 (28%)
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5462
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1111
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
87.820

Return to query results.
Submit another query.