DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3gnt8

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001031817.1 Gene:B3gnt8 / 232984 MGIID:2385269 Length:389 Species:Mus musculus


Alignment Length:379 Identity:88/379 - (23%)
Similarity:142/379 - (37%) Gaps:102/379 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PSRTPSNS------------NDSSLVSNTFDN---HPMGTPPTLASQTPTPPQSS------MHLM 116
            ||.||.|:            ..:..:|:.:.|   ..:|..|:...||.....:|      ::..
Mouse    41 PSPTPPNAEPTLPTNLSARLGQTGPLSSAYWNQQQRQLGVLPSTDCQTWGTVAASEILDFILYPQ 105

  Fly   117 DLPNFVYLIDQPAC-------------------DKDVRALIL-VHSAVRNIEKRRIIRETWANRS 161
            :|..|:.   ..||                   ||||..|:| |.|...:...|:.:||||.   
Mouse   106 ELRRFLL---SAACRSFPLWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETWG--- 164

  Fly   162 YIDQTPL---KVYFL------VGGVSAKS-EKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVM 216
                :|:   ::.||      :||...:| ..|      |:..:|||:..:|.|...|.|.|.::
Mouse   165 ----SPVAGTRLLFLLGSPLGMGGPDLRSLVTW------ESRRYGDLLLWDFLDVPYNRTLKDLL 219

  Fly   217 ALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRV---KR 278
            .|.|.:..|.....:::|.||.|::.|.|:::|.|  ||.         ...||::...:   .:
Mouse   220 LLTWLSHHCPDVNFVLQVQDDAFVHIPALLEHLQT--LPP---------TWARSLYLGEIFTQAK 273

  Fly   279 SYRSKWRVTYKEYPNRF----YPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEE 339
            ..|......|  .|..|    ||.|..|...|.:..:...|.:||.:...|..||| .||.....
Mouse   274 PLRKPGGPFY--VPKTFFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDV-YTGFCFRA 335

  Fly   340 TGSKITPLQH--YLEQKDVRKLVGGEADLEDP---PFLFTNHAIKPDESMTIWQ 388
            .|  :.|..|  :|......:       ..||   ..|...|.:.|.:::.:|:
Mouse   336 LG--LAPRAHPGFLTAWPAER-------TRDPCAVRGLLLVHPVSPQDTIWLWR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 55/215 (26%)
B3gnt8NP_001031817.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57 5/15 (33%)
Galactosyl_T 154..341 CDD:389837 55/215 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D174158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.