DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3gnt4

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_011246501.1 Gene:B3gnt4 / 231727 MGIID:2680208 Length:410 Species:Mus musculus


Alignment Length:403 Identity:100/403 - (24%)
Similarity:163/403 - (40%) Gaps:92/403 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CINLC-LVIWLVSVQQLPMLEAEIIADFSGSGGISSSSTAQPPTSAKSGLRRSRSQPNQIHQPSR 75
            |:..| ||:.|:|.  |.:|:..|                 |..|:|:            ||...
Mouse    67 CVLFCSLVVLLLSC--LLLLKERI-----------------PAGSSKA------------HQQFL 100

  Fly    76 TPSNSNDSSLVSN-TFDNHPMGTPPTLASQTPTPPQSSMHLMDLP-----NFVYLIDQPACDKDV 134
            ....|:.|....| |..|..:..|             |.|.:.|.     ||..|::...|.:|.
Mouse   101 ALPRSHHSQCSPNLTVVNTSLSLP-------------SRHRLFLTYRHCRNFSILLEPSECARDT 152

  Fly   135 RALILVHSAVRNIEKRRIIRETWANR-SYIDQTPLKVYFLVGGVSAKS-------EKWQQFLGRE 191
            ..|:::.|...:||:|..||.||... |:.....||:.||:|......       |.||      
Mouse   153 FLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGRQLKLVFLLGVAGPVPPAQLLVYESWQ------ 211

  Fly   192 NHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPE 256
               ..|::|.:|.:.:.|:|.|.:...:|....|..|..::|.|||||::.|.::::|..     
Mouse   212 ---FDDILQWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLEG----- 268

  Fly   257 YSMLRDP--NLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAA 319
                .||  :.::...:..:|..|:.:.|:.:.:..|..|.||.|..|...|.:...||.|:.|.
Mouse   269 ----WDPAQDFLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAM 329

  Fly   320 QKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADL--EDPPF---LFTNHAIK 379
            ::::.|.:|||.: |:...:.|  :||:.|     ...|..|.:..|  .||..   |...|.:.
Mouse   330 EEAELFPIDDVFV-GMCLRKLG--VTPIHH-----AGFKTFGIQQPLNPRDPCLYKGLLLVHRLS 386

  Fly   380 PDESMTIWQMALD 392
            |.|..|:|.:..|
Mouse   387 PLEMWTMWALVTD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 55/208 (26%)
B3gnt4XP_011246501.1 Galactosyl_T 166..355 CDD:389837 56/209 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.