DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B0024.3

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_505645.2 Gene:B0024.3 / 181815 WormBaseID:WBGene00007096 Length:254 Species:Caenorhabditis elegans


Alignment Length:149 Identity:29/149 - (19%)
Similarity:56/149 - (37%) Gaps:44/149 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPMLEAEIIADFSGSGGI-SSSSTAQPPTSAKSGLRR----SRSQPNQIHQPS--------RTPS 78
            :.:|.:|:|..|...||| .:.|..:....|:.|:.|    |..:.:.::...        :|.:
 Worm     7 ITLLCSEVIGKFGRIGGIGGAKSIGRGGGGARFGVGRGGGASTVRGSSVYSGGFRTGTSGWKTGT 71

  Fly    79 NSNDSSLVSNTFDNHPMGTPPTLASQTPTPPQSSMHLMDLPNFVYLIDQPACDKDVRALILVHSA 143
            :|:.:|..||:|.:       |:.:...:...|.:....|.|                .:::.|.
 Worm    72 SSSSNSYGSNSFRS-------TIFASLYSHAHSPIFSHSLTN----------------ALIISSL 113

  Fly   144 VRNIEKRRIIRETWANRSY 162
            .|.|        |:.||.|
 Worm   114 ARPI--------TYDNRQY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 4/15 (27%)
B0024.3NP_505645.2 CX 124..187 CDD:366767 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.