DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and bre-5

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001255612.1 Gene:bre-5 / 178142 WormBaseID:WBGene00000270 Length:322 Species:Caenorhabditis elegans


Alignment Length:229 Identity:59/229 - (25%)
Similarity:96/229 - (41%) Gaps:37/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGV---------SAKSEKWQQFLGREN 192
            :|::.|:.:|...|..:|:||.....||...:...|:||.|         ..:|||::       
 Worm    80 IIIIKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYK------- 137

  Fly   193 HLHGDLIQGNFKDAYRNMTYKHVMALKWF--NEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLP 255
                |::..:..|:|||.|.|...|:.:.  ..:|:.......||||..::.|.|||:..|....
 Worm   138 ----DILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKE 198

  Fly   256 EY---SMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYE 317
            |.   ..:.|.:....:...||           ::..|||...||.|....|:....|.:.|...
 Worm   199 ELVYEGFVFDTSPFRLKIHKHS-----------ISLNEYPFSRYPPYVSAGAVFLTSETIARFRN 252

  Fly   318 AAQKSKYFWVDDVLITGILAEETGSKITPLQHYL 351
            :.:|.|.|..||| .|||||:......|..::::
 Worm   253 SIRKLKMFPFDDV-FTGILAKTVNVAATHNENFI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 56/212 (26%)
bre-5NP_001255612.1 Galactosyl_T 93..282 CDD:304462 56/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.