DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and bus-2

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001255233.1 Gene:bus-2 / 176977 WormBaseID:WBGene00044618 Length:329 Species:Caenorhabditis elegans


Alignment Length:315 Identity:71/315 - (22%)
Similarity:112/315 - (35%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SSLVSN-TFDNHPMGTP----------PTLASQTPTPPQSSMHLMDLPNFVYLIDQPACDKDVRA 136
            |:||.. .|:|....||          |.|..:.|.|                          ..
 Worm    29 STLVDGIIFNNEDDPTPFDFALSFQLKPELPDELPAP--------------------------NV 67

  Fly   137 LILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQG 201
            |:||.:.....|.|..:|::|||.:   ...::|.||:|   ..::|....:.:|:....|||..
 Worm    68 LVLVTTIASEFEMRNQVRKSWANYT---SNAVRVKFLMG---IPADKQLPLIQKESQEFNDLIIA 126

  Fly   202 NFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDD---VFMNTPQLVKYLATPSLPEYSMLRDP 263
            :..:.|.::..|.:..|.:........:.|||.|.|   :..|..:|.:....|           
 Worm   127 DLDEGYYSLASKTMAMLIYKTRYYPDTKCLVKADVDNVLILRNYERLCEEAVAP----------- 180

  Fly   264 NLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYC-PGMAIVYAPEVVRRLYEAAQKSKYF-- 325
              ::......||......:||.|....|....||.|| .|..::....|.:.|.:.|..|.:.  
 Worm   181 --LILGKCDVSRTVLRNTTKWAVPEFVYSEPVYPTYCSTGTYVLAGKTVPQSLIKEAMSSPFANS 243

  Fly   326 -----WVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLEDPPFLFTN 375
                 ..:||:.||||||:.|.|             |:.:.|.:..|.|.|...|
 Worm   244 LNFRKLSEDVIFTGILAEKAGIK-------------RRHINGLSFFEIPEFFCRN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 51/209 (24%)
bus-2NP_001255233.1 Galactosyl_T 81..269 CDD:304462 51/219 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.