DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3GNT2

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001306004.1 Gene:B3GNT2 / 10678 HGNCID:15629 Length:397 Species:Homo sapiens


Alignment Length:278 Identity:76/278 - (27%)
Similarity:132/278 - (47%) Gaps:27/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NFVYLIDQP-ACDKDVRALILVHSAVRNIEKRRIIRETWANRSYI-DQTPLKVYFLVGGVSAKSE 182
            |:..||||| .|.|....|:.:.|...:..:|:.|||:|...|.. :||.::| ||:|....:..
Human   127 NYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRV-FLLGQTPPEDN 190

  Fly   183 --KWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQL 245
              .....|..|:..|.|::..|::|.:.|::.|.|:.|:|.:..|...:.:.|.|||||:||..:
Human   191 HPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHI 255

  Fly   246 VKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPE 310
            :.||.:     .|..:..:|.:...:|::...|..:.|:.:....| :..||.|..|...:|:..
Human   256 LNYLNS-----LSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVY-SGLYPPYAGGGGFLYSGH 314

  Fly   311 VVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHY------LEQKDVRKLVGGEADLEDP 369
            :..|||....:...:.:||| .||:..::.|  :.|.:|.      :|:|:...:    ....| 
Human   315 LALRLYHITDQVHLYPIDDV-YTGMCLQKLG--LVPEKHKGFRTFDIEEKNKNNI----CSYVD- 371

  Fly   370 PFLFTNHAIKPDESMTIW 387
              |...|:.||.|.:.||
Human   372 --LMLVHSRKPQEMIDIW 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 54/201 (27%)
B3GNT2NP_001306004.1 Galactosyl_T 156..345 CDD:389837 54/198 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.