DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and B3GNT3

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_055071.2 Gene:B3GNT3 / 10331 HGNCID:13528 Length:372 Species:Homo sapiens


Alignment Length:415 Identity:114/415 - (27%)
Similarity:171/415 - (41%) Gaps:81/415 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCLLLICINLCLVIWLVS-----VQQLPMLEAEIIADFSGSGGISSSSTAQPPTSAKSGLRRSR 64
            :|.|.:....|.|...|||     ||:.|....|.:|            ...|||          
Human    12 TLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALA------------WPTPPT---------- 54

  Fly    65 SQPNQIHQPSRTPSNSNDSSLVSNTFDNHPMGTPPTLASQTPTPPQSSMHLMDLPNFVYLIDQP- 128
                   :|:..|.::|.|           |.|.|..|:| |...|:.:......:|..|.|.| 
Human    55 -------RPAPAPCHANTS-----------MVTHPDFATQ-PQHVQNFLLYRHCRHFPLLQDVPP 100

  Fly   129 -ACDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSE--KWQQFLGR 190
             .|.:.|..|:::.|:..|..:|.::|.||.....:....|::.||||..|...|  |..:.|..
Human   101 SKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLEL 165

  Fly   191 ENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLP 255
            |...|||::|.:|.|::.|:|.|.|:.|:|...:||:|..::..|||||.:|..:|.||..    
Human   166 EAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQD---- 226

  Fly   256 EYSMLRDP--NLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEA 318
                 .||  :|.:.:.:.:....|::.||:.|......|..||.||.|...:.:......|..|
Human   227 -----HDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRA 286

  Fly   319 AQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVRKLVGGEADLE-----DPPF---LFTN 375
            |.....|.:|||.: |:..|..|.|  |..|    ..:| ..|..|..:     ||.|   |...
Human   287 AHVLDIFPIDDVFL-GMCLELEGLK--PASH----SGIR-TSGVRAPSQRLSSFDPCFYRDLLLV 343

  Fly   376 HAIKPDESMTIWQMALDRMQRPLLT 400
            |...|.|.:.:|    |.:.:|.||
Human   344 HRFLPYEMLLMW----DALNQPNLT 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 62/202 (31%)
B3GNT3NP_055071.2 Galactosyl_T 122..311 CDD:389837 62/200 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.