DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and b3galt4

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_005167417.1 Gene:b3galt4 / 101886595 ZFINID:ZDB-GENE-081104-482 Length:372 Species:Danio rerio


Alignment Length:267 Identity:77/267 - (28%)
Similarity:114/267 - (42%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PMGTPPTLASQTPTPPQSSMHLMDLPNFVYLIDQPACDKDVRALI-LVHSAVRNIEKRRIIRETW 157
            |...|||.:.:....|  |:|:              |::....|| ||.:|..|.:.|:.||:||
Zfish    68 PHSVPPTRSEEFLLMP--SIHV--------------CERAKPYLITLVATAPPNRKARQAIRDTW 116

  Fly   158 ANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGR----ENHLHGDLIQGNFKDAYRNMTYKHVMAL 218
            ....::....:...|:||      :.....:|:    |:...||||||.|.|.|.|:|.|.:..|
Zfish   117 GGEVHVRGHRVMTLFVVG------QPTDPVIGKELIEESKERGDLIQGRFTDTYTNLTLKTLSIL 175

  Fly   219 KWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRV------K 277
            .|....|..|..:.||||||..|...|::||      ..|..||.:.:|  .::..||      .
Zfish   176 GWARRFCPQAHYVAKVDDDVMFNPNALLQYL------NLSFKRDESELL--ELYLGRVHMQVAPD 232

  Fly   278 RSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAA---QKSKYFWVDDVLITGILAEE 339
            |:..|:..::...|.....|:||.|.|.|.:...:.:|..||   ...|....:||.: ||.|..
Zfish   233 RNPASRHFMSETAYAGMVLPDYCSGTAYVLSRSALLKLSLAAVAINLPKPLPPEDVFV-GICAHT 296

  Fly   340 TGSKITP 346
            .|  |.|
Zfish   297 AG--INP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 63/212 (30%)
b3galt4XP_005167417.1 Galactosyl_T 107..305 CDD:304462 63/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.