DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and LOC101733959

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_031755255.1 Gene:LOC101733959 / 101733959 -ID:- Length:219 Species:Xenopus tropicalis


Alignment Length:138 Identity:45/138 - (32%)
Similarity:73/138 - (52%) Gaps:18/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PNFVYLIDQP-ACDKDVRALI-LVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKS 181
            |.:.|||::| .|..:...|: |:.|..:::..|..:|:||||.|.|....:|..||:|      
 Frog    55 PLYPYLIEEPLKCRGEAPFLVLLIPSMPQDVLVRDALRKTWANESLIPGISIKRIFLLG------ 113

  Fly   182 EKWQQFLG-------RENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVF 239
               :.|:.       :|:....|::|.:|.|.|||:|.|.:|.::|.:..|..|..::|||.|:|
 Frog   114 ---RSFVNDIEISVQQESSTFHDIVQQDFLDTYRNLTVKTLMGIEWVSRLCPRASYVMKVDADMF 175

  Fly   240 MNTPQLVK 247
            .|...|||
 Frog   176 FNPWFLVK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 36/107 (34%)
LOC101733959XP_031755255.1 Galactosyl_T 88..>183 CDD:419759 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136582
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.