DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and LOC101732799

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_012808568.1 Gene:LOC101732799 / 101732799 -ID:- Length:323 Species:Xenopus tropicalis


Alignment Length:292 Identity:86/292 - (29%)
Similarity:138/292 - (47%) Gaps:44/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PNFVYLIDQP-ACDKDVRALI-LVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKS 181
            |.:.|||::| .|..:...|: |:.|..:::..|..:|:||||.|.|....:|..||:|      
 Frog    55 PLYPYLIEEPLQCRGEAPFLVLLIPSMPQDVLVRDALRKTWANESLIPGISIKRIFLLG------ 113

  Fly   182 EKWQQFLG-------RENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVF 239
               :.|:.       :|:....|::|.:|.|.|.|:|.|.:|.::|.:..|..|..::|||.|:|
 Frog   114 ---RSFVNDIEISVEQESSTFHDIVQQDFLDTYHNLTVKTLMGIEWVSRLCPRASYVMKVDADMF 175

  Fly   240 MNTPQLVKYLATPSLP---EYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCP 301
            .|...||:.:..|..|   |:.    ..|::...:..    |:..|||.:.|..||..|||.||.
 Frog   176 FNPWFLVRRILQPEKPLKLEFF----TGLIITIGMPF----RNRGSKWYIPYATYPKFFYPYYCS 232

  Fly   302 GMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKIT-PLQHYLEQKDVRKLVGGEAD 365
            |...|::.::..|:|:.|.....|..:||.: ||..|..|.:|: |...:..|:        .|:
 Frog   233 GTGYVFSGDLSPRIYKEAMGLTLFPFEDVFV-GICLERMGVQISKPGGKWFSQE--------RAE 288

  Fly   366 LEDPPF--LFTNHAIKPDESMTIWQ---MALD 392
            .....|  |.|:|...|||.:.:|.   .|||
 Frog   289 YNRCQFTKLVTDHHYSPDELLKLWPDFLKALD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 63/209 (30%)
LOC101732799XP_012808568.1 Galactosyl_T 88..274 CDD:419759 62/203 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5872
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136582
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm14096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.