DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and b3galt5.2

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_012813706.2 Gene:b3galt5.2 / 100494668 XenbaseID:XB-GENE-992036 Length:311 Species:Xenopus tropicalis


Alignment Length:277 Identity:77/277 - (27%)
Similarity:132/277 - (47%) Gaps:40/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CDKDVRALILV----HSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGR 190
            |:::...|:|:    ||   ..|:|.:||:||.....|....:..|||:|  :..:.:.|:.|..
 Frog    56 CERNPPFLVLLVTTNHS---QKEERNVIRQTWGKERLIGDKLVSTYFLLG--AGTNPRLQEELIE 115

  Fly   191 ENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLP 255
            |::.:.|:||.:|.|:|.|:|.|.:|.::|....|.....::|.|.|:|:|...||:.|...:  
 Frog   116 ESNTYNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQTTFVMKTDTDMFVNPLYLVELLVKKN-- 178

  Fly   256 EYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQ 320
            :.:.|...:|.|     |....|...|||.::..|||...||.:|.|...|::.:|.:|:...:.
 Frog   179 QTTDLFTGSLRL-----HDAPIRDINSKWYISTAEYPQAKYPPFCSGTGYVFSVDVAQRIQNVSS 238

  Fly   321 KSKYFWVDDVLITGILAEETGSKI----TPLQHYLEQK-----DVRKLVGGEADLEDPPFLFTNH 376
            ...:|.::||.: |:..|:....:    |....|..:|     :.||||             |:|
 Frog   239 TVPFFKLEDVYV-GMCLEKLEINLQNLHTETTFYAYKKPFTVCNYRKLV-------------TSH 289

  Fly   377 AIKPDESMTIWQMALDR 393
            .::|.|....|: ||.|
 Frog   290 GVQPGEIYLFWE-ALRR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 58/202 (29%)
b3galt5.2XP_012813706.2 Galactosyl_T 77..265 CDD:419759 56/197 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm14096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.