DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and b3galt5.3

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_004912240.1 Gene:b3galt5.3 / 100493669 XenbaseID:XB-GENE-22064803 Length:316 Species:Xenopus tropicalis


Alignment Length:285 Identity:77/285 - (27%)
Similarity:131/285 - (45%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CDKDVRALILV----HSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGR 190
            |:::...|:|:    ||   .:|.|..||:||..:..|....:..|||:|.|:  :.:.|:.|..
 Frog    61 CERNPPFLVLLVTTTHS---QLEARNAIRQTWGKKRQIGDKRVFTYFLLGTVT--NLRLQEELIE 120

  Fly   191 ENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLA----T 251
            |::.:.|:||.:|.|.|.|:|.|.:|.::|....|.....|:|.|.|:|:||..||:.|.    |
 Frog   121 ESNTYNDIIQRDFIDTYYNLTLKTIMGVEWICTHCPQTTFLMKTDTDMFVNTLYLVELLVKKNQT 185

  Fly   252 PSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLY 316
            .:|...|:..|...:           |...|||.::.||:|...|..:|.|...|::.::..::.
 Frog   186 TNLFTGSLREDDEPI-----------RDMNSKWYISEKEFPGSKYAPFCSGTGYVFSVDIAHKIL 239

  Fly   317 EAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQK-----------DVRKLVGGEADLEDPP 370
            ..:....:|.::||.: |:..|:...|:..|  :.|..           ..||||          
 Frog   240 NVSSTVPFFKLEDVYV-GMCLEKLEIKLQDL--HTETTFFAYRPAFTICGYRKLV---------- 291

  Fly   371 FLFTNHAIKPDESMTIWQMALDRMQ 395
               |:|.::|.|....|: ||.|.:
 Frog   292 ---TSHGVEPYEMYLFWE-ALRRSE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 58/202 (29%)
b3galt5.3XP_004912240.1 Galactosyl_T 80..270 CDD:389837 59/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm14096
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.