DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11357 and LOC100489278

DIOPT Version :9

Sequence 1:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_031755254.1 Gene:LOC100489278 / 100489278 -ID:- Length:387 Species:Xenopus tropicalis


Alignment Length:290 Identity:79/290 - (27%)
Similarity:132/290 - (45%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PNFVYLIDQP-ACDKDVRALI-LVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKS 181
            |.:.|||::| .|..:...|: |:.|..:::..|..:|:||||.|.|....:|..||:|      
 Frog   118 PLYPYLIEEPLRCRGEAPFLVLLIPSMPQDVLVRDALRKTWANESLIPGISIKRIFLLG------ 176

  Fly   182 EKWQQFLG-------RENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVF 239
               :.|:.       :|:....|::|.:|.|.|||:|.|.:|.::|.:..|..|..::|||.|:|
 Frog   177 ---RSFVNDIEISVEQESSTFHDIVQQDFLDTYRNLTVKTLMGIEWVSRLCPRASYVMKVDADMF 238

  Fly   240 MNTPQLVKYLATPSLPEYSMLRDPNLMLC----RSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYC 300
            .|...||:.:..|..|         |.|.    ..:..:..:|:..|||.:.|.||....||.||
 Frog   239 FNPWFLVRQILQPEKP---------LKLAFFTGLVISGASPRRNKNSKWHILYSEYSKNSYPTYC 294

  Fly   301 PGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKIT-PLQHYLEQKDVRKLVGGEA 364
            .|...|::..:...||..|.:.....::||.: |:..:..|..|: |.|::.             
 Frog   295 SGTGYVFSGGLAPLLYRQAMELAILPLEDVFL-GLCLQRIGLYISRPQQNWF------------- 345

  Fly   365 DLEDPPF-------LFTNHAIKPDESMTIW 387
            :|:...:       |.|.|..||.:.:|:|
 Frog   346 NLDRFEYNGCQFARLVTVHHYKPHQLLTLW 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 60/210 (29%)
LOC100489278XP_031755254.1 Galactosyl_T 151..335 CDD:419759 58/202 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5872
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136582
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm14096
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.