DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Fgfr3

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_006251452.1 Gene:Fgfr3 / 84489 RGDID:620714 Length:804 Species:Rattus norvegicus


Alignment Length:399 Identity:120/399 - (30%)
Similarity:183/399 - (45%) Gaps:102/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRI-VAVKTIRACSAQVSLKD---EANIMR 908
            :..|:.:.|...||||.||||..|||..:.....|..: ||||.::..:....|.|   |..:|:
  Rat   464 ELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMK 528

  Fly   909 KLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLA------- 966
            .:|.|:|::.|||||.:..|..:::|||.:|.|...|||.|          |.|...:       
  Rat   529 MIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARR----------PPGMDYSFDACRLP 583

  Fly   967 --PLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKE 1029
              .|:.:.|...|..:|.||||:|.::.:||||||||||:..:.:.||.|||::.|:        
  Rat   584 EEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDV-------- 640

  Fly  1030 QEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRH 1094
                       ||...:                                  ||:.:|.       
  Rat   641 -----------HNLDYY----------------------------------KKTTNGR------- 653

  Fly  1095 ALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKES 1159
             ||::|||||:|...::|.::|:|:||::||||.|||.:||..:...|:.:.:.:|.|.|.|...
  Rat   654 -LPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANC 717

  Fly  1160 RHEFYNLMSRCWHKEPHMRPSFAQ-----SRLEITRSLHKWVD-------------DDSAASDYM 1206
            .|:.|.:|..|||..|..||:|.|     .|:....|..:::|             |..::|...
  Rat   718 THDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSG 782

  Fly  1207 DVSGFSEDL 1215
            |.|.|:.||
  Rat   783 DDSVFTHDL 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 108/341 (32%)
PTKc 860..1187 CDD:270623 109/344 (32%)
Fgfr3XP_006251452.1 IGc2 51..108 CDD:197706
IG 52..123 CDD:214652
Ig2_FGFR 155..239 CDD:143265
IG_like 254..349 CDD:214653
Ig3_FGFR 262..350 CDD:143175
PTKc_FGFR3 457..790 CDD:173652 118/396 (30%)
Pkinase_Tyr 470..746 CDD:285015 109/346 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.