DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Frk

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_077344.1 Gene:Frk / 79209 RGDID:621423 Length:506 Species:Rattus norvegicus


Alignment Length:367 Identity:107/367 - (29%)
Similarity:160/367 - (43%) Gaps:94/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVS-LKDEANIMRKLG 911
            :.:|::|:|...||.|.||:||:       |.:..|..|||||::..|...: ...||.||:.| 
  Rat   229 EIDRNSIQLLKRLGSGQFGEVWE-------GLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKSL- 285

  Fly   912 SHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGF 976
            .|..::.|...|...:|..:|.|....|.|...|:             ..|.|...|:.:  ...
  Rat   286 RHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQ-------------NDGGSKIRLTQQ--VDM 335

  Fly   977 ALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRH 1041
            |..:|.||.|:..:..:||||||||||:..:.:.|:.|||:                        
  Rat   336 AAQVASGMAYLESQNYIHRDLAARNVLVGEHNIYKVADFGL------------------------ 376

  Fly  1042 NAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESL 1106
             |..||.|....|..:|                     |.|             ||::|.|||::
  Rat   377 -ARVFKVDNEDIYESKH---------------------EIK-------------LPVKWTAPEAI 406

  Fly  1107 QYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRCW 1171
            :.:.|:.::|:|:|||:|:||.|.|..|||.:||.:||..:.|..|...|.....:||::|..||
  Rat   407 RTNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIHMLGQNYRLPQPSNCPEQFYSIMMECW 471

  Fly  1172 HKEPHMRPSFAQSRLEITRSLHKWVDDD--SAASDYMDVSGF 1211
            :.||..||:|        .:|| |..:|  ...|.|.|.:.|
  Rat   472 NVEPKQRPTF--------ETLH-WKLEDYFEPDSSYSDTNNF 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 98/329 (30%)
PTKc 860..1187 CDD:270623 96/327 (29%)
FrkNP_077344.1 SH3_Src_like 48..105 CDD:212779
SH2_Src_Frk 113..208 CDD:199831
PTKc_Frk_like 226..495 CDD:270653 103/356 (29%)
Pkinase_Tyr 235..488 CDD:285015 101/343 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.