DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and SRC

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_016883513.1 Gene:SRC / 6714 HGNCID:11283 Length:542 Species:Homo sapiens


Alignment Length:611 Identity:146/611 - (23%)
Similarity:226/611 - (36%) Gaps:201/611 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 NTSDCGVTP---------------------RTQTQPSHTTDSSPKILRTTVLTSIRS----TVHP 665
            |:||...:|                     ||:|..|.......:|:..|....:|.    ..| 
Human    68 NSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWWLAH- 131

  Fly   666 RPTSTSTTTSTTTTAPPAVTAPSNEV-----YIGIVESSSSASPADISSTVIANER-DLNMEMRR 724
                 |.:|..|...|....|||:.:     |.|.:....|             || .||.|..|
Human   132 -----SLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRES-------------ERLLLNAENPR 178

  Fly   725 MNLVTLVLVAVGVIPLAAIILYLVRNFVIRRRAKQSEVFDVCITDQQPIS-------PVKKVD-- 780
                                    ..|::|........:.:.::|.....       .::|:|  
Human   179 ------------------------GTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSG 219

  Fly   781 -----SKYQVDDDEDEVDHQHHQHMQHHQNHQNHQNHQHHQAMPMSQASQRDANHNRYGNNDDKT 840
                 |:.|.:..:        |.:.::..|.:...|:.....|.|:...:              
Human   220 GFYITSRTQFNSLQ--------QLVAYYSKHADGLCHRLTTVCPTSKPQTQ-------------- 262

  Fly   841 SLASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR--ACSAQVSLKDE 903
            .||.:..:..|.::||:..||:|.||:||       .|.:..|..||:||::  ..|.:..|: |
Human   263 GLAKDAWEIPRESLRLEVKLGQGCFGEVW-------MGTWNGTTRVAIKTLKPGTMSPEAFLQ-E 319

  Fly   904 ANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPL 968
            |.:|:|| .|:.:|.|. |.|..||..::.||..:|.||..|:........||            
Human   320 AQVMKKL-RHEKLVQLY-AVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLP------------ 370

  Fly   969 SPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKN 1033
               .|...|..||.||.|:.....|||||.|.|:|:..|.:||:.|||::      |:.::.|..
Human   371 ---QLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLA------RLIEDNEYT 426

  Fly  1034 AANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPI 1098
            |..              |:::                                          ||
Human   427 ARQ--------------GAKF------------------------------------------PI 435

  Fly  1099 RWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEF 1163
            :|.|||:..|..||.::|:|:|||:|.|:.|.|..||..:..|||:.:|.:|.|...|.|.....
Human   436 KWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESL 500

  Fly  1164 YNLMSRCWHKEPHMRPSF--AQSRLE 1187
            ::||.:||.|||..||:|  .|:.||
Human   501 HDLMCQCWRKEPEERPTFEYLQAFLE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 100/332 (30%)
PTKc 860..1187 CDD:270623 99/330 (30%)
SRCXP_016883513.1 SH3_Src 88..149 CDD:212941 13/66 (20%)
SH2_Src_Src 153..253 CDD:198228 19/144 (13%)
PTKc_Src 266..542 CDD:270656 104/348 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.