DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and RET

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_066124.1 Gene:RET / 5979 HGNCID:9967 Length:1114 Species:Homo sapiens


Alignment Length:430 Identity:132/430 - (30%)
Similarity:197/430 - (45%) Gaps:105/430 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 QAMPMSQAS------QRDANHNRYGNNDDKTSLASEFHDFERSNIRLKSLLGEGNFGQVWKAEAD 874
            ||.|:|.:|      ..|:..|:...:..|. |.....:|.|.|:.|...||||.||:|.||.|.
Human   681 QAFPVSYSSSGARRPSLDSMENQVSVDAFKI-LEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAF 744

  Fly   875 DLSGHFGATRIVAVKTIRACSAQVSLKD---EANIMRKLGSHQNVVTLLGACVESEPHMLIMEYA 936
            .|.|..|.| .||||.::..::...|:|   |.|::::: :|.:|:.|.|||.:..|.:||:|||
Human   745 HLKGRAGYT-TVAVKMLKENASPSELRDLLSEFNVLKQV-NHPHVIKLYGACSQDGPLLLIVEYA 807

  Fly   937 MRGRLLSLLRAARSATNILPASVPGGRSL----------APLSPRTLAGFALDIACGMEYIAGRR 991
            ..|.|...||.:|   .:.|..:..|.|.          ..|:...|..||..|:.||:|:|..:
Human   808 KYGSLRGFLRESR---KVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMK 869

  Fly   992 IVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRHNAHKFKFDFGSRYIL 1056
            :|||||||||:|:......||.|||:|.|:..|                           ..|: 
Human   870 LVHRDLAARNILVAEGRKMKISDFGLSRDVYEE---------------------------DSYV- 906

  Fly  1057 QHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESLQYHMFTTETDIWAFG 1121
                   .:.||:                          :|::|||.|||..|::||::|:|:||
Human   907 -------KRSQGR--------------------------IPVKWMAIESLFDHIYTTQSDVWSFG 938

  Fly  1122 IVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRCWHKEPHMRPSFAQSRL 1186
            ::||||.|||..||..:....:...:..|.|.:.|.....|.|.||.:||.:||..||.||    
Human   939 VLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFA---- 999

  Fly  1187 EITRSLHKWVDDDSAASDYMDVS------------GFSED 1214
            :|::.|.|.:   ....||:|::            |.||:
Human  1000 DISKDLEKMM---VKRRDYLDLAASTPSDSLIYDDGLSEE 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 110/341 (32%)
PTKc 860..1187 CDD:270623 110/339 (32%)
RETNP_066124.1 Cadherin 172..261 CDD:278457
PTKc_RET 723..1012 CDD:173631 115/361 (32%)
Pkinase_Tyr 724..1005 CDD:285015 112/350 (32%)
Inhibitors binding 805..807 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.