DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and hck

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001015722.1 Gene:hck / 548439 XenbaseID:XB-GENE-6048191 Length:498 Species:Xenopus tropicalis


Alignment Length:343 Identity:103/343 - (30%)
Similarity:156/343 - (45%) Gaps:88/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACS-AQVSLKDEANIMRKLG 911
            :..|.::.|:..||.|.||.||.|   ..:||    ..|||||::|.| :..:..:|||:|:.| 
 Frog   227 EIPRESLSLQKKLGTGQFGDVWLA---TYNGH----TEVAVKTMKAGSMSPAAFLEEANLMKSL- 283

  Fly   912 SHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGF 976
            .|:.:|.|.....:.||..::.||..:|.||..|::            |.| |..|::  .|..|
 Frog   284 QHERLVRLHAVVTQGEPIYIVTEYMHKGSLLDFLKS------------PEG-SRQPVT--QLIDF 333

  Fly   977 ALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRH 1041
            ...||.||.:|..|..:||||.|.|.|:....:|||.|||::      |:.::.|..|..     
 Frog   334 CAQIAEGMWFIEQRNYIHRDLRAANCLVSETLLCKIADFGLA------RVIEDSEYTARE----- 387

  Fly  1042 NAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESL 1106
                     ||::                                          ||:|.:||:.
 Frog   388 ---------GSKF------------------------------------------PIKWTSPEAA 401

  Fly  1107 QYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRCW 1171
            .|..||.::|||:||::|.||.|.|.:||..::..||:..:.:|.|...|.....|.|.:|.:||
 Frog   402 NYGSFTIKSDIWSFGVLLSEIMTYGRSPYPGMSNSEVMAALERGYRMPCPGTCPTELYGIMLQCW 466

  Fly  1172 HKEPHMRPSF--AQSRLE 1187
            .::||.||:|  .|:.||
 Frog   467 QQDPHKRPTFEYLQNILE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 99/331 (30%)
PTKc 860..1187 CDD:270623 99/329 (30%)
hckNP_001015722.1 SH3 57..112 CDD:388381
SH2_Src_family 115..211 CDD:199827
PTKc_Src_like 237..484 CDD:270630 99/331 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.