DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and FGFRL1

DIOPT Version :10

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_024309860.1 Gene:FGFRL1 / 53834 HGNCID:3693 Length:527 Species:Homo sapiens


Alignment Length:422 Identity:78/422 - (18%)
Similarity:132/422 - (31%) Gaps:95/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 PAVMGKGIP--------------SKTNSMEDDVEEEEDELKPY------VYFGAKLPPIRPGGLT 359
            ||...:|.|              .:|..::..||.:...|..:      ::.|.....:.|.||.
Human    44 PAAAARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWTKDGRTIHSGWSRFRVLPQGLK 108

  Fly   360 IKAAEGDDDHPRVLEVS---VAQSTTPTITTTSTTPAPVSSTRPTASTRRPLTPVERSRSKYKY- 420
            :|..|.:|....|.:.:   .:.|...|:...........|..|.:|:.....|..:..::.:: 
Human   109 VKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFT 173

  Fly   421 ---HMRERGLVPTAAPPPAAPPAPPVSRTRYVGSGRPTAGLSDSIQDLKQTESEVAKPVVRR--- 479
               .||.|.:         |.|.....|.:.|.||.|...::....|...|..|.|:|..::   
Human   174 QPSKMRRRVI---------ARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTL 229

  Fly   480 VVQKVSPSSSTPLIITVLSAEEETTVGQTEALPTDESTTTTSTTTTTEKPSTTTSTSTTTT---- 540
            .::.:.|..|......|  :.....:..|..:...:.|.:....|.|...:||.....||:    
Human   230 SLKNLRPEDSGKYTCRV--SNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCK 292

  Fly   541 -----TPVPSTSKRTTTNAPLSTTNTPTTTTSSTTPSTTTTSSTSTTVIPT----TTKANSIIEK 596
                 .||....||....|            .....||.........|:||    :....|.:.|
Human   293 VRSDVKPVIQWLKRVEYGA------------EGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNK 345

  Fly   597 DKELIRALGPALTREINIDDANNLIVFCNNTSDCGVTPRTQTQPSHTTDSSPKILRTTVLTSIRS 661
                      .|......|||...|  |...:..|.:                 .|:..||.:..
Human   346 ----------LLITRARQDDAGMYI--CLGANTMGYS-----------------FRSAFLTVLPD 381

  Fly   662 TVHPRPTSTSTTTSTTTTAPPAVTAPSNEVYI 693
            ...|.|...|::::|:...|..:..|:..|:|
Human   382 PKPPGPPVASSSSATSLPWPVVIGIPAGAVFI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581
FGFRL1XP_024309860.1 I-set 56..139 CDD:400151 14/82 (17%)
Ig strand B 70..74 CDD:409390 0/3 (0%)
Ig strand C 83..87 CDD:409390 1/3 (33%)
Ig strand E 105..109 CDD:409390 2/3 (67%)
Ig strand F 119..124 CDD:409390 1/4 (25%)
Ig strand G 132..135 CDD:409390 1/2 (50%)
IgI_2_FGFRL1-like 170..261 CDD:409442 19/101 (19%)
Ig strand A 170..173 CDD:409442 0/2 (0%)
Ig strand A' 181..186 CDD:409442 2/13 (15%)
Ig strand B 190..198 CDD:409442 2/7 (29%)
Ig strand C 204..209 CDD:409442 0/4 (0%)
Ig strand C' 212..214 CDD:409442 0/1 (0%)
Ig strand D 220..223 CDD:409442 1/2 (50%)
Ig strand E 227..232 CDD:409442 0/4 (0%)
Ig strand F 241..248 CDD:409442 1/8 (13%)
Ig strand G 251..261 CDD:409442 1/9 (11%)
Ig 269..377 CDD:472250 26/148 (18%)
Ig strand B 287..291 CDD:409363 1/3 (33%)
Ig strand C 300..304 CDD:409363 1/3 (33%)
Ig strand E 344..348 CDD:409363 1/13 (8%)
Ig strand F 358..363 CDD:409363 2/6 (33%)
Ig strand G 371..374 CDD:409363 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.