DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and PDGFRL

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001359002.1 Gene:PDGFRL / 5157 HGNCID:8805 Length:375 Species:Homo sapiens


Alignment Length:224 Identity:40/224 - (17%)
Similarity:62/224 - (27%) Gaps:89/224 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   849 FERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVSLKDEANIMRKLGSH 913
            |:.|.:.:|.....|....|....||  :|.|..       .::.||..:..||||    |.||.
Human   112 FKDSRLSVKQNERYGQLTLVNSTSAD--TGEFSC-------WVQLCSGYICRKDEA----KTGST 163

  Fly   914 QNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGFAL 978
            ....|..|......|....:.|         |...|.|.                          
Human   164 YIFFTEKGELFVPSPSYFDVVY---------LNPDRQAV-------------------------- 193

  Fly   979 DIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRHNA 1043
             :.|.:..::.:..:||:..|:.:..:          |..|..|.:|                  
Human   194 -VPCRVTVLSAKVTLHREFPAKEIPAN----------GTDIVYDMKR------------------ 229

  Fly  1044 HKFKFDFGSRYILQHWQHTFGQGQGQGHC 1072
                   |..|:..|.:|     ||..:|
Human   230 -------GFVYLQPHSEH-----QGVVYC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 38/219 (17%)
PTKc 860..1187 CDD:270623 37/213 (17%)
PDGFRLNP_001359002.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..64
IG_like 83..145 CDD:214653 9/41 (22%)
Ig 293..372 CDD:386229
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.