DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and PDGFRA

DIOPT Version :10

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001334757.1 Gene:PDGFRA / 5156 HGNCID:8803 Length:1114 Species:Homo sapiens


Alignment Length:72 Identity:18/72 - (25%)
Similarity:28/72 - (38%) Gaps:20/72 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KGSSYNLITKNCNHFCDETCIKLTGNPIPSWVNRLARIGKFSGFMCNCVLPATINATRFGNNRVN 167
            ||:|.||.|       ::....|.|..|.:.|| |.::.:...|:|..:            ||..
Human   201 KGASGNLAT-------EDLVYMLNGLGIHTGVN-LQKLLEAGDFICQAL------------NRKT 245

  Fly   168 QDKSCEA 174
            ..|..:|
Human   246 SSKVAQA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581
PDGFRANP_001334757.1 Ig_3 53..125 CDD:464046
IgI_PDGFR-alphabeta 237..335 CDD:409447 5/28 (18%)
Ig strand A 237..241 CDD:409447 1/3 (33%)
Ig strand A' 248..252 CDD:409447 1/3 (33%)
Ig strand B 254..263 CDD:409447
Ig strand C 268..273 CDD:409447
Ig strand C' 276..278 CDD:409447
Ig strand D 282..290 CDD:409447
Ig strand E 294..302 CDD:409447
Ig strand F 312..318 CDD:409447
Ig strand G 323..329 CDD:409447
Ig4_PDGFR 338..438 CDD:409445
PTKc_PDGFR_alpha 580..981 CDD:173653
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.