DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and yes1

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001008186.1 Gene:yes1 / 493548 XenbaseID:XB-GENE-495082 Length:537 Species:Xenopus tropicalis


Alignment Length:352 Identity:108/352 - (30%)
Similarity:153/352 - (43%) Gaps:95/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   842 LASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR-ACSAQVSLKDEAN 905
            |:.:..:..|.::||...||:|.||:||       .|.:..|..||:||:: ......:...||.
 Frog   259 LSKDAWEIPRESLRLDVKLGQGCFGEVW-------IGTWNGTTKVAIKTLKPGTMMPEAFLQEAQ 316

  Fly   906 IMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSP 970
            ||:|| .|..:|.|. |.|..||..::.||..:|.||..|:........||              
 Frog   317 IMKKL-RHDKLVPLY-AVVSEEPIYIVTEYMTKGSLLDFLKEGDGKYLKLP-------------- 365

  Fly   971 RTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAA 1035
             .|...|..||.||.||.....:||||.|.|:|:..|.:|||.|||::      |:.::.|..|.
 Frog   366 -QLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLA------RLIEDNEYTAR 423

  Fly  1036 NDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRW 1100
            .              |:::                                          ||:|
 Frog   424 Q--------------GAKF------------------------------------------PIKW 432

  Fly  1101 MAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPK---ESRHE 1162
            .|||:..|..||.::|:|:|||:|.|:.|.|..||..:..|||:.:|.:|.|...|:   ||.||
 Frog   433 TAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHE 497

  Fly  1163 FYNLMSRCWHKEPHMRPSF--AQSRLE 1187
               ||..||.|:|..||:|  .||.||
 Frog   498 ---LMKLCWKKDPDERPTFEYIQSFLE 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 102/334 (31%)
PTKc 860..1187 CDD:270623 102/332 (31%)
yes1NP_001008186.1 SH3_Yes 88..145 CDD:212940
SH2_Src_family 148..247 CDD:199827
PTKc_Yes 258..536 CDD:270654 108/352 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.