DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Ret

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster


Alignment Length:405 Identity:130/405 - (32%)
Similarity:196/405 - (48%) Gaps:94/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   832 RYGNNDDKTSLASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSA 896
            |:.:.|.|       .:|.|..::|.::||||.||||.|..|.:::|..|.| .||||.::..|.
  Fly   756 RFESGDAK-------WEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGIT-TVAVKMLKKGSN 812

  Fly   897 QV---SLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPAS 958
            .|   :|..|..::::: ||.||:.|||||..||..:||:|||..|.|.|.||.:|   .|..|.
  Fly   813 SVEYMALLSEFQLLQEV-SHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSR---KIECAG 873

  Fly   959 VPGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDA 1023
            |.....:.|::.:.:..||..|..||.|::..::||||||||||||....:|||.|||::.|:  
  Fly   874 VDFADGVEPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDV-- 936

  Fly  1024 ERMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHD 1088
                  .|.:|                   |:                         |:|     
  Fly   937 ------YEDDA-------------------YL-------------------------KRS----- 946

  Fly  1089 TIGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRP 1153
                |..:|::|||||||..|::|:::|:|:||::.||:.|||::||..:..:.:...:..|.|.
  Fly   947 ----RDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRM 1007

  Fly  1154 DLPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSL---HKWVD-------------DDSAA 1202
            |.|:......|:::..||..||:.||||.....|..:.|   .|::|             ||||.
  Fly  1008 DRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKLLGNNAKYIDLETNAVSNPLYCGDDSAL 1072

  Fly  1203 SDYMDVSGFSEDLEH 1217
              .....|..|.|:|
  Fly  1073 --ITTELGEPESLQH 1085

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 113/331 (34%)
PTKc 860..1187 CDD:270623 112/329 (34%)
RetNP_477044.1 PKc_like 770..1049 CDD:304357 115/344 (33%)
TyrKc 771..1042 CDD:197581 113/336 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.