DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and InR

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster


Alignment Length:394 Identity:111/394 - (28%)
Similarity:179/394 - (45%) Gaps:92/394 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFE--RSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSA---QVSLKDEANIM 907
            |:|  |.||...:.||:|:||.|::........: |..|..|:||:...:.   :.:...||::|
  Fly  1363 DWEVLRENIIQLAPLGQGSFGMVYEGILKSFPPN-GVDRECAIKTVNENATDRERTNFLSEASVM 1426

  Fly   908 RKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAAR-------SATNILPASVPGGRSL 965
            ::..:: :||.|||.|...:|.:::||...:|.|.|.|||.|       ..|.:....|.|  ::
  Fly  1427 KEFDTY-HVVRLLGVCSRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTG--NV 1488

  Fly   966 APLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDL-DAERMRKE 1029
            .|.:...:...|::||.||.|:|.::.|||||||||.::..:...||.||||:.|: :.:..|| 
  Fly  1489 QPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRK- 1552

  Fly  1030 QEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRH 1094
                                                                         |.:.
  Fly  1553 -------------------------------------------------------------GTKG 1556

  Fly  1095 ALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKES 1159
            .||:|||.||||:..::::.:|:::||:||||:|||.:.||..|:..:|:|.|..|...:.|:..
  Fly  1557 LLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPENC 1621

  Fly  1160 RHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASDYMDVSGFSEDLEHGVVYFNH 1224
            ....:.||.||||.....||||    |:|.    .:::.....|.:.:||.:     |......|
  Fly  1622 PDFLHKLMQRCWHHRSSARPSF----LDII----AYLEPQCPNSQFKEVSFY-----HSEAGLQH 1673

  Fly  1225 RISE 1228
            |..|
  Fly  1674 REKE 1677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 98/339 (29%)
PTKc 860..1187 CDD:270623 97/337 (29%)
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020
PTKc_InsR_like 1364..1652 CDD:173625 103/361 (29%)
Pkinase_Tyr 1371..1650 CDD:285015 100/352 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.