DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Sdr

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001287331.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster


Alignment Length:315 Identity:56/315 - (17%)
Similarity:97/315 - (30%) Gaps:115/315 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 YKYHMRERGLVPTAAPPPAAPPAPPVSRTRYVGSGRPTAGLSDSIQDLKQTESEVAKPVVRRVVQ 482
            |.||.:|               ||..:.|.|  .||...|..:.:.|:...:|.      |.|:.
  Fly   520 YSYHYKE---------------APVQNVTMY--DGRHGCGHDNWLMDVVPNQSR------RHVIS 561

  Fly   483 KVSPSSSTPLIITVLSAEE-------ETTVGQTEALPTDESTTTTSTTTTTEKPSTTTSTSTTTT 540
            .:.|.:.....:..|:..|       .:.:|..:.||              ::||          
  Fly   562 GLKPYTQYAYFVKTLTRTEYHIQIDAYSKIGYFQTLP--------------DRPS---------- 602

  Fly   541 TPVPSTSKRTTTNAPLSTTNTPTTTTSSTTPSTTTTSSTSTTVIPTTTKANSIIE-KDKELIRAL 604
             ||......:..::.:.....|....:....:...|:.          |.|:..| |||..:   
  Fly   603 -PVLRIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAE----------KYNATKEAKDKNYV--- 653

  Fly   605 GPALTREINIDDANNLIVFCNNTSDC---GVTP-RTQTQPSHT----------TDSSP------- 648
                  .:.:::|.::        ||   ||.| .:..||...          .|:.|       
  Fly   654 ------NVELENAKDI--------DCECAGVLPYYSGPQPDDEDYYNKEQITYEDALPNLIYVSR 704

  Fly   649 ----------KILRTTVLTSIRSTVHP-RPTSTSTTTSTTTTAPPAVTAPSNEVY 692
                      |::....|.||:....| ||.:|:...:..|.|...:.|.:.|.|
  Fly   705 NHDYRRKEFEKVINYEHLLSIKKDEEPTRPPTTTPAPTNATLAKERLAAINYENY 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581
PTKc 860..1187 CDD:270623
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382
Furin-like 209..332 CDD:279142
Recep_L_domain 347..461 CDD:279382
FN3 491..578 CDD:214495 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.