DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and fgfrl1a

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_956670.1 Gene:fgfrl1a / 393347 ZFINID:ZDB-GENE-040128-2 Length:483 Species:Danio rerio


Alignment Length:104 Identity:26/104 - (25%)
Similarity:39/104 - (37%) Gaps:27/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 RALGPAL-TREINIDDANNLIVFCNNTSDC--------------------GVTPRTQTQPSHTTD 645
            |.|..|| .:|:..|||...|  |..|:..                    |..|..:|:  ::||
Zfish    73 RVLQQALRIKEVEADDAGTFI--CKATNGFGSVNINYTLIVIDDSSAGREGARPAGETE--YSTD 133

  Fly   646 SSPKILRT--TVLTSIRSTVHPRPTSTSTTTSTTTTAPP 682
            .:.|::|.  |....:|..|..||..:|.....|.:..|
Zfish   134 LTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581
PTKc 860..1187 CDD:270623
fgfrl1aNP_956670.1 I-set 32..111 CDD:254352 11/39 (28%)
IGc2 38..101 CDD:197706 11/29 (38%)
I-set 141..232 CDD:254352 8/32 (25%)
Ig2_FGFRL1-like 151..232 CDD:143264 6/22 (27%)
I-set 245..349 CDD:254352
Ig 255..350 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.