DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and fyna

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001315092.1 Gene:fyna / 373872 ZFINID:ZDB-GENE-030903-5 Length:537 Species:Danio rerio


Alignment Length:426 Identity:112/426 - (26%)
Similarity:172/426 - (40%) Gaps:119/426 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 DDDEDEVDHQHHQHMQHHQN----------HQNHQNHQHHQA-----------MPMSQASQRDAN 829
            |.||.:.||..|..::...|          .:..|...||.:           :|..:...|.| 
Zfish   191 DWDETKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVHHYSARAAGLCCRLIVPCHKGMPRLA- 254

  Fly   830 HNRYGNNDDKTSLASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR-A 893
                    |.:....:..:..|.:::|...||.|.||:||       .|.:.....|||||:: .
Zfish   255 --------DLSVKTKDVWEIPRESLQLIKRLGNGQFGEVW-------MGTWNGNTKVAVKTLKPG 304

  Fly   894 CSAQVSLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPAS 958
            ..:..|..:||.||:|| .|..:|.|. |.|..||..::.||..:|.||..|:........||  
Zfish   305 TMSPESFLEEAQIMKKL-RHDKLVQLY-AVVSEEPIYIVTEYMSKGSLLDFLKDGEGRGLKLP-- 365

  Fly   959 VPGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDA 1023
                         .|...|..:|.||.||.....:||||.:.|:|:..:.:|||.|||::     
Zfish   366 -------------NLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLA----- 412

  Fly  1024 ERMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHD 1088
             |:.::.|..|..              |:::                                  
Zfish   413 -RLIEDNEYTARQ--------------GAKF---------------------------------- 428

  Fly  1089 TIGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRP 1153
                    ||:|.|||:..|..||.::|:|:|||:|.|:.|.|..||..:..|||:.:|.:|.|.
Zfish   429 --------PIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRM 485

  Fly  1154 DLPKESRHEFYNLMSRCWHKEPHMRPSF--AQSRLE 1187
            ..|::.....:.||.:||.::|..||:|  .|:.||
Zfish   486 PCPQDCPSSLHELMLQCWKRDPEERPTFEYLQAFLE 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 94/331 (28%)
PTKc 860..1187 CDD:270623 94/329 (29%)
fynaNP_001315092.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..34
SH3_Fyn_Yrk 85..140 CDD:212939
SH2_Src_Fyn_isoform_a_like 145..245 CDD:198281 10/53 (19%)
PTKc_Fyn 261..534 CDD:270655 98/347 (28%)
Pkinase_Tyr 271..520 CDD:285015 95/334 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.