DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Ack-like

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster


Alignment Length:347 Identity:99/347 - (28%)
Similarity:145/347 - (41%) Gaps:91/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   847 HDFERSNIRLKSLLGEGNFG----QVWKAEADDLSGHFGATRI-VAVKTI---RACSAQVSLKDE 903
            |.....:|.:...||.|.||    .||..         |..|| ||:|.:   |..|..:....|
  Fly   126 HIIPADSISVNKQLGTGEFGIVQQGVWSN---------GNERIQVAIKCLCRERMQSNPMEFLKE 181

  Fly   904 ANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPL 968
            |.||..: .|:|:|.|.|..:.::..||:.|.|   .|.|||...:.:          |..::.|
  Fly   182 AAIMHSI-EHENIVRLYGVVLATDSLMLVTELA---HLRSLLECLKDS----------GLRVSFL 232

  Fly   969 SPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKN 1033
            :..||..|||.|..||.|:..:|::||||||||:|:......||.|||:|..|...:        
  Fly   233 TIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGK-------- 289

  Fly  1034 AANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPI 1098
                    :.:|..|:...:                                          |||
  Fly   290 --------DYYKTNFNVNLK------------------------------------------LPI 304

  Fly  1099 RWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRV--PQGLRPDLPKESRH 1161
            .|.|||.:.|..||..:|:||||:.|||:.:.|..|::.|||.:::..:  |...|.:.|.....
  Fly   305 AWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPS 369

  Fly  1162 EFYNLMSRCWHKEPHMRPSFAQ 1183
            |:|.||.:||..:...||.|.:
  Fly   370 EYYTLMMKCWQDDAAKRPRFGE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 98/338 (29%)
PTKc 860..1187 CDD:270623 97/334 (29%)
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 98/340 (29%)
PTKc_Ack_like 137..398 CDD:270636 97/336 (29%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.