DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Ror

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:391 Identity:111/391 - (28%)
Similarity:166/391 - (42%) Gaps:93/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 RDANHNRYGNNDDKTSLASE---------FHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFG 881
            :||.....||..|..:|.|:         .:.|...::.....||||.||:|:|.:   |.....
  Fly   373 QDAGRGNLGNLSDHVALNSKLIERNTLLRINHFTLQDVEFLEELGEGAFGKVYKGQ---LLQPNK 434

  Fly   882 ATRIVAVKTIR---ACSAQVSLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLS 943
            .|..||:|.::   :...|...|.|..::..| .|||:|.:||..:..||:.::.||...|.|..
  Fly   435 TTITVAIKALKENASVKTQQDFKREIELISDL-KHQNIVCILGVVLNKEPYCMLFEYMANGDLHE 498

  Fly   944 LLRAARSATNILPASVPGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNG 1008
            .| .:.|.|.        |:||:.|.   ....||.|:.||:|::....|||||||||.|::...
  Fly   499 FL-ISNSPTE--------GKSLSQLE---FLQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGL 551

  Fly  1009 MCKICDFGMSIDLDAERMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCS 1073
            :.||.|||:|.|:.:....:.|.|:                                        
  Fly   552 VVKISDFGLSRDIYSSDYYRVQSKS---------------------------------------- 576

  Fly  1074 KDQPHGEKKSHHGHDTIGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQL 1138
                                 .||:|||..||:.|..||||:|:|:||:|||||.:.|..||...
  Fly   577 ---------------------LLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGF 620

  Fly  1139 TGREVIRRVPQGLRPDLPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAAS 1203
            :.:|||..:........|:......|:||..|||::...||:|.    :|:..|..|.:....||
  Fly   621 SNQEVINLIRSRQLLSAPENCPTAVYSLMIECWHEQSVKRPTFT----DISNRLKTWHEGHFKAS 681

  Fly  1204 D 1204
            :
  Fly   682 N 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 98/331 (30%)
PTKc 860..1187 CDD:270623 98/329 (30%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 101/349 (29%)
Pkinase_Tyr 410..670 CDD:285015 99/340 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.