DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and yrk

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001352482.1 Gene:yrk / 337571 ZFINID:ZDB-GENE-030131-9517 Length:528 Species:Danio rerio


Alignment Length:344 Identity:104/344 - (30%)
Similarity:149/344 - (43%) Gaps:91/344 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR--ACSAQVSLKDEANIMRKL 910
            :..|.:::|...||.|.||:||       .|.:..|..|||||::  ..|.:..| |||.||::|
Zfish   256 EIPRESLQLIKKLGNGQFGEVW-------MGMWNGTTKVAVKTLKPGTMSPEAFL-DEAQIMKRL 312

  Fly   911 GSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAG 975
             .|..:|.|. |.|..||..:|.|:..:|.||..|:........||               .|..
Zfish   313 -RHDKLVQLY-AVVSEEPIYIITEFMSQGSLLDFLKDGDGRNLKLP---------------QLVD 360

  Fly   976 FALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMR 1040
            .|..||.||.||.....:||||.|.|:|:....:|||.|||::      |:.::.|..|..    
Zfish   361 MAAQIAAGMAYIERMNYIHRDLRAANILVGDGLVCKIADFGLA------RLIEDNEYTARQ---- 415

  Fly  1041 HNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPES 1105
                      |:::                                          ||:|.|||:
Zfish   416 ----------GAKF------------------------------------------PIKWTAPEA 428

  Fly  1106 LQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRC 1170
            ..|..||.::|:|:|||:|.|:.|.|..||..:..|||:.:|.:|.|...|:.|....:.||.:|
Zfish   429 ALYGKFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCPQGSPASLHELMLQC 493

  Fly  1171 WHKEPHMRPSF--AQSRLE 1187
            |.|:|..|.:|  .||.||
Zfish   494 WRKDPDERHTFEYLQSFLE 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 99/332 (30%)
PTKc 860..1187 CDD:270623 100/330 (30%)
yrkNP_001352482.1 SH3 76..133 CDD:327375
SH2 136..234 CDD:326550
PTKc_Src_Fyn_like 266..513 CDD:271105 102/334 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.