DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and styk1b

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001292494.1 Gene:styk1b / 324714 ZFINID:ZDB-GENE-030131-3435 Length:447 Species:Danio rerio


Alignment Length:344 Identity:78/344 - (22%)
Similarity:138/344 - (40%) Gaps:99/344 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 LKDEAN------------IMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSAT 952
            |||.|:            .:.:||.|..:..|||......|.:.::|......||..|...|. .
Zfish   178 LKDSASNQESQSFLGFAAFLSQLGPHPFLPELLGVISLRAPLITVIEEMENRDLLGFLWRCRQ-D 241

  Fly   953 NILPASVPGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICD--- 1014
            |:      |...:..::.:.:...|..:|..::::.|:.:.|.:|.|||||:.     :||.   
Zfish   242 NV------GPDGMCQMTEKKIFNMASHVASALDFLHGKDLHHCNLKARNVLVS-----RICTAKL 295

  Fly  1015 FGMSIDLDAERMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHG 1079
            :|:                  :||               |:         :..|.|:.|:|.  |
Zfish   296 WGL------------------DDL---------------YV---------RTSGSGNYSEDP--G 316

  Fly  1080 EKKSHHGHDTIGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVI 1144
            .||                 |.|||.|.....|.::|||:||::|:|:.|||..|::::..:|::
Zfish   317 RKK-----------------WQAPELLAKRPSTPKSDIWSFGLLLYEMVTLGEVPFAEIPVKELL 364

  Fly  1145 RRVPQGLRP-DLPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSA------- 1201
            :. .|.::| ..|....:..|:::..|.|.:...|||.|:.|.:: :|..|...|.|.       
Zfish   365 QH-HQRVKPIRKPNNCSNSLYSIIKSCCHWKEQDRPSLAEVRRKL-QSGEKSASDSSVLRVPEPI 427

  Fly  1202 -ASDYMDVSGFSEDLEHGV 1219
             ...|:..:|:.|...:.|
Zfish   428 NIQQYLKEAGYGESNSYTV 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 68/298 (23%)
PTKc 860..1187 CDD:270623 70/302 (23%)
styk1bNP_001292494.1 PKc_like 164..409 CDD:304357 70/305 (23%)
Pkinase_Tyr 164..408 CDD:285015 70/303 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.