DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and HCK

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_002101.2 Gene:HCK / 3055 HGNCID:4840 Length:526 Species:Homo sapiens


Alignment Length:581 Identity:141/581 - (24%)
Similarity:232/581 - (39%) Gaps:155/581 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 STVHPRPTSTSTTTSTTTTAPPAVTAPSNEVYIGIVESSSSASPADIS-----STVIANERDLNM 720
            ||:.|.|.|.::.|      |....|.|.::.:..:....:....|:|     ..|:..|.....
Human    57 STIKPGPNSHNSNT------PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWW 115

  Fly   721 EMRRMNLVTLVLVAVGVIPLAAIILYLVRNFVIRRRAKQSEVF--------DVCITDQQPISPVK 777
            :.|     :|.....|.||         .|:|.|..:.::|.:        |   .::|.::|..
Human   116 KAR-----SLATRKEGYIP---------SNYVARVDSLETEEWFFKGISRKD---AERQLLAPGN 163

  Fly   778 KVDSKYQVDDDED----------EVDHQHHQHMQHHQNHQNHQNHQHHQAMPMSQASQRDANHNR 832
            .:.| :.:.|.|.          :.|.:....::|::.........:..........|...:|.:
Human   164 MLGS-FMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYK 227

  Fly   833 YGNND--DKTSL-----------ASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATR 884
            .||:.  .|.|:           ..:..:..|.:::|:..||.|.||:||.|.       :....
Human   228 KGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT-------YNKHT 285

  Fly   885 IVAVKTIRACSAQV-SLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAA 948
            .|||||::..|..| :...|||:|:.| .|..:|. |.|.|..||..:|.|:..:|.||..|::.
Human   286 KVAVKTMKPGSMSVEAFLAEANVMKTL-QHDKLVK-LHAVVTKEPIYIITEFMAKGSLLDFLKSD 348

  Fly   949 RSATNILPASVPGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKIC 1013
            ..:...||               .|..|:..||.||.:|..|..:||||.|.|:|:..:.:|||.
Human   349 EGSKQPLP---------------KLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIA 398

  Fly  1014 DFGMSIDLDAERMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPH 1078
            |||::      |:.::.|..|..              |:::                        
Human   399 DFGLA------RVIEDNEYTARE--------------GAKF------------------------ 419

  Fly  1079 GEKKSHHGHDTIGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREV 1143
                              ||:|.|||::.:..||.::|:|:|||:|.||.|.|..||..::..||
Human   420 ------------------PIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEV 466

  Fly  1144 IRRVPQGLRPDLPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASD 1204
            ||.:.:|.|...|:....|.||:|.|||...|..||:|     |..:|:   :||...|::
Human   467 IRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTF-----EYIQSV---LDDFYTATE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 99/329 (30%)
PTKc 860..1187 CDD:270623 98/327 (30%)
HCKNP_002101.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH3 82..137 CDD:302595 12/68 (18%)
SH2_Src_HCK 140..243 CDD:198226 15/106 (14%)
PKc_like 254..524 CDD:304357 105/360 (29%)
Pkinase_Tyr 262..511 CDD:285015 101/342 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.