DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Fyn

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_006256584.1 Gene:Fyn / 25150 RGDID:2641 Length:575 Species:Rattus norvegicus


Alignment Length:458 Identity:116/458 - (25%)
Similarity:175/458 - (38%) Gaps:145/458 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 DDDEDEVDHQHHQHMQHHQN-----------HQNHQNHQHHQAMPMSQASQRDAN---------H 830
            |.|:.:.||..|..::...|           ....|..||:        |:|.|.         |
  Rat   229 DWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY--------SERAAGLCCRLVVPCH 285

  Fly   831 NRYGNNDDKTSLASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR-AC 894
            .......|.:....:..:..|.:::|...||.|.||:||       .|.:.....||:||:: ..
  Rat   286 KGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVW-------MGTWNGNTKVAIKTLKPGT 343

  Fly   895 SAQVSLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASV 959
            .:..|..:||.||:|| .|..:|.|. |.|..||..::.||..:|.||..|:........||   
  Rat   344 MSPESFLEEAQIMKKL-KHDKLVQLY-AVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLP--- 403

  Fly   960 PGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAE 1024
                        .|...|..:|.||.||.....:||||.:.|:|:.:..:|||.|||::      
  Rat   404 ------------NLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLA------ 450

  Fly  1025 RMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDT 1089
            |:.::.|..|..              |:::                                   
  Rat   451 RLIEDNEYTARQ--------------GAKF----------------------------------- 466

  Fly  1090 IGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPD 1154
                   ||:|.|||:..|..||.::|:|:|||:|.|:.|.|..||..:..|||:.:|.:|.|..
  Rat   467 -------PIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMP 524

  Fly  1155 LPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASDYMDVSGFSEDLEHGV 1219
            .|::.....:.||..||.|:|..||:|                      :|:  .||.||     
  Rat   525 CPQDCPISLHELMIHCWKKDPEERPTF----------------------EYL--QGFLED----- 560

  Fly  1220 VYF 1222
             ||
  Rat   561 -YF 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 94/329 (29%)
PTKc 860..1187 CDD:270623 93/327 (28%)
FynXP_006256584.1 SH3_Fyn_Yrk 123..178 CDD:212939
SH2_Src_Fyn_isoform_a_like 183..283 CDD:198281 12/61 (20%)
PTKc_Fyn 299..572 CDD:270655 102/380 (27%)
Pkinase_Tyr 309..558 CDD:285015 96/358 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.