DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Fgfr2

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_036844.1 Gene:Fgfr2 / 25022 RGDID:2611 Length:841 Species:Rattus norvegicus


Alignment Length:980 Identity:215/980 - (21%)
Similarity:344/980 - (35%) Gaps:324/980 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 TITTTS---------TTPAPVSSTRPTAS-----TRRPLTPVERSRSKYKYHMRERGLVPTAAPP 434
            |:|..|         .|.|.:|..||:.|     |..|    |...:||:....|..:|   ||.
  Rat    17 TVTMVSWGRFICLVLVTMATLSLARPSFSLVEDTTLEP----EEPPTKYQISQPEACVV---APG 74

  Fly   435 PA------APPAPPVSRTR---YVGSGRPTAGLSDSIQDLKQTESEVAKPVVRRVVQKVSP-SSS 489
            .:      ...|..:|.|:   ::|....|..:.:.:|                 ::..:| .|.
  Rat    75 ESLELRCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQ-----------------IKGATPRDSG 122

  Fly   490 TPLIITVLSAEEET---TVGQTEALPT--DESTTTTSTTTTTEKPSTTTSTSTTTT--------- 540
            ........:.:.||   .|..|:|:.:  ||..|.:|....:|..|...:...|.|         
  Rat   123 LYACAAARTVDSETLYFMVNVTDAISSGDDEDDTDSSEDFVSENRSNQRAPYWTNTEKMEKRLHA 187

  Fly   541 TPVPSTSKRTTTNAPLSTTNTPT---------------------------TTTSSTTPSTTTTSS 578
            .|..:|.|   ...|.....|||                           ....|..||   ...
  Rat   188 VPAANTVK---FRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPS---DKG 246

  Fly   579 TSTTVIPTT------TKANSIIEKD--KELIRALGPALTREINIDDANNLIVFCNNTSDCGVTPR 635
            ..|.::...      |....::|:.  :.:::|..||....:...|..   ..|...||  ..|.
  Rat   247 NYTCLVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVE---FVCKVYSD--AQPH 306

  Fly   636 TQ-------TQPSHTTDSSP--KILRTTVLTSIRSTVHPRPTSTSTTTSTTTTAPPAVTAPSNEV 691
            .|       ....:..|..|  |:|:.:.:.|..:.|      .:....|...|...:...||  
  Rat   307 IQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEV------LALFNVTEMDAGEYICKVSN-- 363

  Fly   692 YIG-----------------IVESSSSASPADISSTVIANERDLNMEMRRMNLVTLVLVAVGVIP 739
            |||                 :.|...:|||                     :.:.:.:..:||..
  Rat   364 YIGQANQSAWLTVLPKQQAPVREKEITASP---------------------DYLEIAIYCIGVFL 407

  Fly   740 LAAIILYLVRNFVIRRRAKQSEVFDVCITDQQPI--SPVKKVDSKYQVDDDEDEVDHQHHQHMQH 802
            :|.:::.::  |...:...:...|     ..||.  ...|::..:.||                 
  Rat   408 IACMVVTVI--FCRMKTTTKKPDF-----SSQPAVHKLTKRIPLRRQV----------------- 448

  Fly   803 HQNHQNHQNHQHHQAMPMSQASQRDANHN--------RYGNNDDKTSLA--SEFH-------DFE 850
                            .:|..|....|.|        |..:..|...||  ||:.       :|.
  Rat   449 ----------------TVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFP 497

  Fly   851 RSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRI-VAVKTIRACSAQVSLKD---EANIMRKLG 911
            |..:.|...||||.||||..|||..:........: ||||.::..:.:..|.|   |..:|:.:|
  Rat   498 RDKLTLGKPLGEGCFGQVVMAEAVGIDKDRPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIG 562

  Fly   912 SHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLA---------P 967
            .|:|::.|||||.:..|..:|:|||.:|.|...|||.|          |.|...:         .
  Rat   563 KHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARR----------PPGMEYSYDINRVPEEQ 617

  Fly   968 LSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEK 1032
            ::.:.|......:|.||||:|.::.:||||||||||:..|.:.||.|||::.|::          
  Rat   618 MTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIN---------- 672

  Fly  1033 NAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALP 1097
                          ..|:                             .||:.:|.        ||
  Rat   673 --------------NIDY-----------------------------YKKTTNGR--------LP 686

  Fly  1098 IRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHE 1162
            ::|||||:|...::|.::|:|:||:::|||.|||.:||..:...|:.:.:.:|.|.|.|....:|
  Rat   687 VKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNE 751

  Fly  1163 FYNLMSRCWHKEPHMRPSFAQ---------------SRLEITRSLHKW---VDDDSAASDYMDVS 1209
            .|.:|..|||..|..||:|.|               ..|::|:.|.::   ..|..::....|.|
  Rat   752 LYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLTQPLEQYSPSYPDTRSSCSSGDDS 816

  Fly  1210 GFSED 1214
            .||.|
  Rat   817 VFSPD 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 105/341 (31%)
PTKc 860..1187 CDD:270623 105/354 (30%)
Fgfr2NP_036844.1 Ig 50..143 CDD:416386 20/116 (17%)
Ig strand A 50..53 CDD:409353 1/2 (50%)
Ig strand A' 66..72 CDD:409353 2/8 (25%)
Ig strand B 75..85 CDD:409353 0/9 (0%)
Ig strand C 88..93 CDD:409353 1/4 (25%)
Ig strand C' 96..98 CDD:409353 0/1 (0%)
Ig strand D 103..107 CDD:409353 1/3 (33%)
Ig strand E 110..115 CDD:409353 1/21 (5%)
Ig strand F 121..130 CDD:409353 1/8 (13%)
Ig strand G 133..143 CDD:409353 3/9 (33%)
IgI_2_FGFR 173..267 CDD:409443 14/99 (14%)
Ig strand B 194..198 CDD:409443 1/6 (17%)
Ig strand C 207..211 CDD:409443 1/3 (33%)
Ig strand E 233..237 CDD:409443 0/3 (0%)
Ig strand F 247..252 CDD:409443 1/4 (25%)
Ig strand G 260..263 CDD:409443 0/2 (0%)
Ig 275..377 CDD:416386 22/114 (19%)
Ig strand A 275..278 CDD:409353 0/2 (0%)
Ig strand A' 282..286 CDD:409353 2/3 (67%)
Ig strand B 294..301 CDD:409353 1/9 (11%)
Ig strand C 305..312 CDD:409353 2/6 (33%)
Ig strand D 327..332 CDD:409353 1/4 (25%)
Ig strand E 342..347 CDD:409353 1/10 (10%)
Ig strand F 355..363 CDD:409353 0/7 (0%)
Ig strand G 366..374 CDD:409353 1/7 (14%)
FGFR3_TM 391..421 CDD:407957 7/52 (13%)
PTKc_FGFR2 476..788 CDD:270679 113/382 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.