DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Pdgfrb

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_113713.1 Gene:Pdgfrb / 24629 RGDID:3285 Length:1097 Species:Rattus norvegicus


Alignment Length:474 Identity:132/474 - (27%)
Similarity:189/474 - (39%) Gaps:171/474 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   841 SLASEFHDF----------------ERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVK 889
            |::|:.|::                .|..:.|...||.|.||||.:|.|..|| |..||..||||
  Rat   570 SVSSDGHEYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLS-HSQATMKVAVK 633

  Fly   890 TIRA---CSAQVSLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAAR-- 949
            .:::   .|.:.:|..|..||..||.|.|||.|||||.:..|..:|.||...|.|:..|...:  
  Rat   634 MLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHT 698

  Fly   950 -----------SATNILPASVPGGRSL-------------------------------------- 965
                       .:|.:...::|.|.||                                      
  Rat   699 FLQRHSNKHCPPSTELYSNALPVGLSLPSHLNLTGESDGGYMDMSKDESVDYVPMLDMKGHIKYA 763

  Fly   966 -----------------AP--------------LSPRTLAGFALDIACGMEYIAGRRIVHRDLAA 999
                             ||              ||...|.||:..:|.|||::|.:..|||||||
  Rat   764 DIESSSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAA 828

  Fly  1000 RNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFG 1064
            ||||:....:.||||||:                 |.|:||.:.:..|   ||.:          
  Rat   829 RNVLICEGKLVKICDFGL-----------------ARDIMRDSNYISK---GSTF---------- 863

  Fly  1065 QGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIAT 1129
                                           ||::||||||:...::||.:|:|:|||:||||.|
  Rat   864 -------------------------------LPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFT 897

  Fly  1130 LGSTPYSQL-TGREVIRRVPQGLRPDLPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSL- 1192
            ||.|||.:| ...:....:.:|.|...|..:..|.|.:|.:||.::...||.|:|..|.:.|.| 
  Rat   898 LGGTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERLLG 962

  Fly  1193 ------HKWVDDDSAASDY 1205
                  ::.||::...||:
  Rat   963 EGYKKKYQQVDEEFLRSDH 981

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 120/414 (29%)
PTKc 860..1187 CDD:270623 120/412 (29%)
PdgfrbNP_113713.1 ig 36..113 CDD:395002
Ig strand B 49..53 CDD:409353
Ig strand C 59..62 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 96..101 CDD:409353
Ig 211..309 CDD:416386
Ig strand A 211..215 CDD:409353
Ig strand A' 222..226 CDD:409353
Ig strand B 228..237 CDD:409353
Ig strand C 242..247 CDD:409353
Ig strand C' 250..252 CDD:409353
Ig strand D 256..264 CDD:409353
Ig strand E 270..277 CDD:409353
Ig strand F 287..293 CDD:409353
Ig strand G 298..304 CDD:409353
Ig 313..414 CDD:416386
PKc_like 561..952 CDD:419665 124/443 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.