DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and FGFR2

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_006717771.1 Gene:FGFR2 / 2263 HGNCID:3689 Length:839 Species:Homo sapiens


Alignment Length:432 Identity:125/432 - (28%)
Similarity:195/432 - (45%) Gaps:110/432 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 HQHHQAMPM----SQASQRDANHN--------RYGNNDDKTSLA--SEFH-------DFERSNIR 855
            |:..:.:|:    |..|....|.|        |..:..|...||  ||:.       :|.|..:.
Human   436 HKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLT 500

  Fly   856 LKSLLGEGNFGQVWKAEADDLSGHFGATRI-VAVKTIRACSAQVSLKD---EANIMRKLGSHQNV 916
            |...||||.||||..|||..:........: ||||.::..:.:..|.|   |..:|:.:|.|:|:
Human   501 LGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNI 565

  Fly   917 VTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLA---------PLSPRT 972
            :.|||||.:..|..:|:|||.:|.|...|||.|          |.|...:         .::.:.
Human   566 INLLGACTQDGPLYVIVEYASKGNLREYLRARR----------PPGMEYSYDINRVPEEQMTFKD 620

  Fly   973 LAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAAND 1037
            |......:|.||||:|.::.:||||||||||:..|.:.||.|||::.|::               
Human   621 LVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIN--------------- 670

  Fly  1038 LMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMA 1102
                     ..|:                             .||:.:|.        ||::|||
Human   671 ---------NIDY-----------------------------YKKTTNGR--------LPVKWMA 689

  Fly  1103 PESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLM 1167
            ||:|...::|.::|:|:||:::|||.|||.:||..:...|:.:.:.:|.|.|.|....:|.|.:|
Human   690 PEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMM 754

  Fly  1168 SRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASDYMDVS 1209
            ..|||..|..||:|.|...::.|.|....::     :|:|:|
Human   755 RDCWHAVPSQRPTFKQLVEDLDRILTLTTNE-----EYLDLS 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 105/341 (31%)
PTKc 860..1187 CDD:270623 105/339 (31%)
FGFR2XP_006717771.1 Ig1_FGFR 66..143 CDD:143174
IG_like 66..143 CDD:214653
Ig2_FGFR 183..267 CDD:143265
IG_like 282..376 CDD:214653
Ig3_FGFR 290..377 CDD:143175
PTKc_FGFR2 474..786 CDD:270679 115/387 (30%)
Pkinase_Tyr 499..775 CDD:285015 106/346 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.