DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Srms

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_035611.3 Gene:Srms / 20811 MGIID:101865 Length:507 Species:Mus musculus


Alignment Length:348 Identity:103/348 - (29%)
Similarity:154/348 - (44%) Gaps:91/348 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 RSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVSLKDEANIMRKLGS--H 913
            ||...|:..||||.||:||:       |.:..:..||||.|:  ||.:.|.|....:..|.|  |
Mouse   242 RSEFVLRRKLGEGFFGEVWE-------GLWLGSIPVAVKVIK--SADMKLADLTKEIEALKSLRH 297

  Fly   914 QNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGFAL 978
            :.::.|...|...||..::.|...:|.|...|.::......||               .|.|||.
Mouse   298 ERLIRLHAICSLGEPVYIVTELMGKGNLQVYLGSSEGKALSLP---------------HLLGFAC 347

  Fly   979 DIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRHNA 1043
            .:|.||.|:..||:|||||||||||:..:..||:.|||::      |:.|:...:.::       
Mouse   348 QVAEGMSYLEERRVVHRDLAARNVLVGDDLTCKVADFGLA------RLLKDDVYSPSS------- 399

  Fly  1044 HKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESLQY 1108
                   ||:                                          :|::|.|||:..|
Mouse   400 -------GSK------------------------------------------IPVKWTAPEAANY 415

  Fly  1109 HMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRCWHK 1173
            .:|:.::|:|:|||:|:|:.|.|..||..:|..|.::::.:|.|...|.....|.|.||..||..
Mouse   416 RVFSQKSDVWSFGILLYEVFTYGQCPYEGMTNHETLQQISRGYRLPRPAVCPAEVYVLMVECWKG 480

  Fly  1174 EPHMRPSFAQSRLE---ITRSLH 1193
            .|..||:||..|.:   |.|.||
Mouse   481 SPEERPTFAILREKLNAINRRLH 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 95/330 (29%)
PTKc 860..1187 CDD:270623 96/328 (29%)
SrmsNP_035611.3 SH3 70..124 CDD:302595
SH2_Srm 134..212 CDD:198223
PTKc_Srm_Brk 238..498 CDD:133248 99/341 (29%)
STYKc 246..495 CDD:214568 97/334 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.