powered by:
Protein Alignment Tie and F40G9.8
DIOPT Version :9
Sequence 1: | NP_523928.1 |
Gene: | Tie / 38559 |
FlyBaseID: | FBgn0014073 |
Length: | 1233 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367839.1 |
Gene: | F40G9.8 / 185556 |
WormBaseID: | WBGene00018244 |
Length: | 273 |
Species: | Caenorhabditis elegans |
Alignment Length: | 45 |
Identity: | 12/45 - (26%) |
Similarity: | 20/45 - (44%) |
Gaps: | 4/45 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 FSPGDVDVVGDKPTTYRPSGANRPSIAPLNSAQDRERKLMNVLAA 185
|.|..::.|.| .:|:.|:.||..|......::..|..:|.|
Worm 200 FEPMFLETVID----VKPASASAPSEMPFTGGSSKQSLLFYILLA 240
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tie | NP_523928.1 |
TyrKc |
854..1183 |
CDD:197581 |
|
PTKc |
860..1187 |
CDD:270623 |
|
F40G9.8 | NP_001367839.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0200 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.