DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Lyn

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001104566.1 Gene:Lyn / 17096 MGIID:96892 Length:512 Species:Mus musculus


Alignment Length:344 Identity:103/344 - (29%)
Similarity:155/344 - (45%) Gaps:90/344 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 DFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR--ACSAQVSLKDEANIMRKL 910
            :..|.:|:|...||.|.||:||       .|::..:..|||||::  ..|.|..| :|||:|:.|
Mouse   241 EIPRESIKLVKKLGAGQFGEVW-------MGYYNNSTKVAVKTLKPGTMSVQAFL-EEANLMKTL 297

  Fly   911 GSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAG 975
             .|..:|.|.....:.||..:|.|:..:|.||..|:           |..||:.|.|    .|..
Mouse   298 -QHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLK-----------SDEGGKVLLP----KLID 346

  Fly   976 FALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMR 1040
            |:..||.||.||..:..:||||.|.|||:..:.||||.|||::      |:.::.|..|..    
Mouse   347 FSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLA------RVIEDNEYTARE---- 401

  Fly  1041 HNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPES 1105
                      |:::                                          ||:|.|||:
Mouse   402 ----------GAKF------------------------------------------PIKWTAPEA 414

  Fly  1106 LQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRC 1170
            :.:..||.::|:|:|||:|:||.|.|..||...|..:|:..:.||.|....:....|.|::|..|
Mouse   415 INFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMC 479

  Fly  1171 WHKEPHMRPSF--AQSRLE 1187
            |.::...||:|  .||.|:
Mouse   480 WKEKAEERPTFDYLQSVLD 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 99/332 (30%)
PTKc 860..1187 CDD:270623 99/330 (30%)
LynNP_001104566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
SH3_Lyn 67..122 CDD:212937
SH2_Src_Lyn 125..225 CDD:198227
PTKc_Lyn 239..510 CDD:270657 103/344 (30%)
Pkinase_Tyr 247..497 CDD:285015 101/335 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.