DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Lck

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_001155904.1 Gene:Lck / 16818 MGIID:96756 Length:520 Species:Mus musculus


Alignment Length:355 Identity:103/355 - (29%)
Similarity:154/355 - (43%) Gaps:95/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 RSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACS-AQVSLKDEANIMRKLGSHQ 914
            |..::|...||.|.||:||       .|::.....||||:::..| :..:...|||:|::| .|.
Mouse   253 RETLKLVERLGAGQFGEVW-------MGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQL-QHP 309

  Fly   915 NVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGFALD 979
            .:|.|. |.|..||..:|.||...|.|:..|:            .|.|   ..|:...|...|..
Mouse   310 RLVRLY-AVVTQEPIYIITEYMENGSLVDFLK------------TPSG---IKLNVNKLLDMAAQ 358

  Fly   980 IACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRHNAH 1044
            ||.||.:|..:..:||||.|.|:|:.....|||.|||::      |:.::.|..|..        
Mouse   359 IAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLA------RLIEDNEYTARE-------- 409

  Fly  1045 KFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPESLQYH 1109
                  |:::                                          ||:|.|||::.|.
Mouse   410 ------GAKF------------------------------------------PIKWTAPEAINYG 426

  Fly  1110 MFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRCWHKE 1174
            .||.::|:|:|||:|.||.|.|..||..:|..|||:.:.:|.|...|.....|.|:||..||.:.
Mouse   427 TFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER 491

  Fly  1175 PHMRPSFAQSRLEITRSLHKWVDDDSAASD 1204
            |..||:|     :..||:   :||...|::
Mouse   492 PEDRPTF-----DYLRSV---LDDFFTATE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 97/329 (29%)
PTKc 860..1187 CDD:270623 96/327 (29%)
LckNP_001155904.1 SH3_Lck 76..129 CDD:212938
SH2_Src_Lck 134..234 CDD:198225
PTKc_Lck_Blk 248..511 CDD:270652 102/351 (29%)
Pkinase_Tyr 256..505 CDD:285015 99/342 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.