DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Hck

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:NP_034537.2 Gene:Hck / 15162 MGIID:96052 Length:524 Species:Mus musculus


Alignment Length:619 Identity:145/619 - (23%)
Similarity:238/619 - (38%) Gaps:163/619 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   631 GVTPRTQTQPSHTTDSSPKILRTTVLTSIRSTVH-PRPTSTSTT-TSTTTTAPPAVTAPSNEVYI 693
            |..||.....|.......|..:|....:.:..|: |.|||:|.. .:.:.:.||           
Mouse    17 GRAPRMGCVKSRFLRDGSKASKTEPSANQKGPVYVPDPTSSSKLGPNNSNSMPP----------- 70

  Fly   694 GIVESSSSASPADISSTVIANERDLNMEMRRMNLV-----------TLVLVAVGVIPLAAIILYL 747
            |.||.|.......:......:..||:.:.....:|           :|.....|.||        
Mouse    71 GFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGEWWKARSLATKKEGYIP-------- 127

  Fly   748 VRNFVIRRRAKQSEVF--------DVCITDQQPISPVKKVDSKYQVDDDED----------EVDH 794
             .|:|.|..:.::|.:        |   .::..::|...:.| :.:.|.|.          :.|.
Mouse   128 -SNYVARVNSLETEEWFFKGISRKD---AERHLLAPGNMLGS-FMIRDSETTKGSYSLSVRDFDP 187

  Fly   795 QHHQHMQHHQNHQNHQNHQHHQAMPMSQASQRDANHNRYGNND--DKTSL-----------ASEF 846
            ||...::|::.........:........:.|....|.:.|.:.  .|.|:           ..:.
Mouse   188 QHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVLHYKKGKDGLCQKLSVPCVSPKPQKPWEKDA 252

  Fly   847 HDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQV-SLKDEANIMRKL 910
            .:..|.:::::..||.|.||:||.|.       :.....|||||::..|..| :...|||:|:.|
Mouse   253 WEIPRESLQMEKKLGAGQFGEVWMAT-------YNKHTKVAVKTMKPGSMSVEAFLAEANLMKSL 310

  Fly   911 GSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAG 975
             .|..:|. |.|.|..||..::.|:..:|.||..|::...:...||               .|..
Mouse   311 -QHDKLVK-LHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLP---------------KLID 358

  Fly   976 FALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMR 1040
            |:..|:.||.:|..|..:||||.|.|:|:..:.:|||.|||::      |:.::.|..|..    
Mouse   359 FSAQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLA------RIIEDNEYTARE---- 413

  Fly  1041 HNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRWMAPES 1105
                      |:::                                          ||:|.|||:
Mouse   414 ----------GAKF------------------------------------------PIKWTAPEA 426

  Fly  1106 LQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYNLMSRC 1170
            :.:..||.::|:|:|||:|.||.|.|..||..::..||||.:..|.|...|.....|.||:|.||
Mouse   427 INFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNCPEELYNIMIRC 491

  Fly  1171 WHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASD 1204
            |...|..||:|     |..:|:   :||...|::
Mouse   492 WKNRPEERPTF-----EYIQSV---LDDFYTATE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 96/329 (29%)
PTKc 860..1187 CDD:270623 96/327 (29%)
HckNP_034537.2 SH3 80..135 CDD:302595 10/63 (16%)
SH2_Src_HCK 138..241 CDD:198226 15/106 (14%)
PKc_like 252..522 CDD:304357 102/360 (28%)
Pkinase_Tyr 260..509 CDD:285015 98/342 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.