DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tie and Fyn

DIOPT Version :9

Sequence 1:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster
Sequence 2:XP_030100741.1 Gene:Fyn / 14360 MGIID:95602 Length:576 Species:Mus musculus


Alignment Length:458 Identity:116/458 - (25%)
Similarity:175/458 - (38%) Gaps:145/458 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 DDDEDEVDHQHHQHMQHHQN-----------HQNHQNHQHHQAMPMSQASQRDAN---------H 830
            |.|:.:.||..|..::...|           ....|..||:        |:|.|.         |
Mouse   230 DWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY--------SERAAGLCCRLVVPCH 286

  Fly   831 NRYGNNDDKTSLASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIR-AC 894
            .......|.:....:..:..|.:::|...||.|.||:||       .|.:.....||:||:: ..
Mouse   287 KGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVW-------MGTWNGNTKVAIKTLKPGT 344

  Fly   895 SAQVSLKDEANIMRKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASV 959
            .:..|..:||.||:|| .|..:|.|. |.|..||..::.||..:|.||..|:........||   
Mouse   345 MSPESFLEEAQIMKKL-KHDKLVQLY-AVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLP--- 404

  Fly   960 PGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAE 1024
                        .|...|..:|.||.||.....:||||.:.|:|:.:..:|||.|||::      
Mouse   405 ------------NLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLA------ 451

  Fly  1025 RMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDT 1089
            |:.::.|..|..              |:::                                   
Mouse   452 RLIEDNEYTARQ--------------GAKF----------------------------------- 467

  Fly  1090 IGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPD 1154
                   ||:|.|||:..|..||.::|:|:|||:|.|:.|.|..||..:..|||:.:|.:|.|..
Mouse   468 -------PIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMP 525

  Fly  1155 LPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEITRSLHKWVDDDSAASDYMDVSGFSEDLEHGV 1219
            .|::.....:.||..||.|:|..||:|                      :|:  .||.||     
Mouse   526 CPQDCPISLHELMIHCWKKDPEERPTF----------------------EYL--QGFLED----- 561

  Fly  1220 VYF 1222
             ||
Mouse   562 -YF 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TieNP_523928.1 TyrKc 854..1183 CDD:197581 94/329 (29%)
PTKc 860..1187 CDD:270623 93/327 (28%)
FynXP_030100741.1 SH3_Fyn_Yrk 124..179 CDD:212939
SH2_Src_Fyn_isoform_a_like 184..284 CDD:198281 12/61 (20%)
PTKc_Fyn 300..573 CDD:270655 102/380 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.